DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10809 and AgaP_AGAP007703

DIOPT Version :9

Sequence 1:NP_001163403.1 Gene:CG10809 / 39159 FlyBaseID:FBgn0036052 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_001237043.1 Gene:AgaP_AGAP007703 / 4576287 VectorBaseID:AGAP007703 Length:319 Species:Anopheles gambiae


Alignment Length:336 Identity:84/336 - (25%)
Similarity:143/336 - (42%) Gaps:71/336 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 SSPNTHGEWPHMNINLNLNMSSNPSTNASFQLSRDRGEHFALPHLPPLPLNPNASNAEYLPSLIH 129
            |.||.....|...:....:..|:.|.:.:.|.:.:..:.  .|...|.   .:|:::.....|.|
Mosquito    10 SGPNDTSAIPATAVEAEKDSESDSSISCAKQTADNNDDE--CPKTFPF---TDANDSPSAGDLAH 69

  Fly   130 PSTLPSGSKSFKMRPRMQRLKH-SYSY-----SNIIVQSNGRKLRTAASTCNIELLNRILEGGAN 188
                 |...:.|:|.:..||:: |..|     |.::|.    :...|.|..|.|.:..::..|.:
Mosquito    70 -----STRCNLKVRTKCHRLQNRSSPYRTIRPSALLVS----RFLEAVSHNNTEKVQEMIHQGMS 125

  Fly   189 PNAADEY-NRSPLHLAACRGYIPIVQQLLKYGANPNVVDSLGNTPLHLAVISASSNNFNVVVGVL 252
            ||.::.| |||.||:|..||:..||:.||:.|||||:.|...||||||    |||.....||.:|
Mosquito   126 PNTSESYFNRSALHIACSRGFRDIVRLLLENGANPNIRDKNMNTPLHL----ASSTESVEVVQML 186

  Fly   253 LQGGASVHMYDRSNKSPLELAEAKLRL---LRNRYDHPT--------PETAKILEDMCMLTTLIL 306
            |..|.:|.:.|.:....|:.:..||||   |.::....|        .:||    |:|.....:.
Mosquito   187 LDYGTNVLLRDSNGLLALDFSIGKLRLSERLISKMQKLTQSDIHKHREKTA----DVCERIFAVF 247

  Fly   307 RYMVK---------QQRELE------------------DLSALEKRLQNLSTSDDQEQVVSQTAD 344
            :..|:         .|.:||                  ||.::..::.||....:    :....:
Mosquito   248 KQQVRNLDLPRQGLDQEKLEQMLNDFSEQLGKVRQRHIDLDSIVDQISNLKVKSE----IDSDVN 308

  Fly   345 ELLASVERLSI 355
            .||:::::.::
Mosquito   309 SLLSTLQQFTL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10809NP_001163403.1 Ank_2 167..263 CDD:289560 41/96 (43%)
ANK repeat 167..193 CDD:293786 7/25 (28%)
ANK 170..276 CDD:238125 43/106 (41%)
ANK repeat 195..226 CDD:293786 18/31 (58%)
ANK repeat 228..263 CDD:293786 15/34 (44%)
AgaP_AGAP007703XP_001237043.1 ANK repeat 102..131 CDD:293786 7/32 (22%)
Ank_2 104..197 CDD:289560 41/96 (43%)
ANK 107..208 CDD:238125 43/104 (41%)
ANK repeat 133..164 CDD:293786 17/30 (57%)
ANK repeat 166..197 CDD:293786 15/34 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BJ6N
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto106434
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.