Sequence 1: | NP_001163403.1 | Gene: | CG10809 / 39159 | FlyBaseID: | FBgn0036052 | Length: | 358 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_731193.1 | Gene: | wtrw / 40931 | FlyBaseID: | FBgn0260005 | Length: | 986 | Species: | Drosophila melanogaster |
Alignment Length: | 209 | Identity: | 55/209 - (26%) |
---|---|---|---|
Similarity: | 85/209 - (40%) | Gaps: | 48/209 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 114 LNPNASNAEYLPSLIHPSTLPSGSKSFKM-------------RPRMQR-LKHSYSYSNII----- 159
Fly 160 ----------VQSNG-RKLRTAASTCNIELLNRILEGGANPNA-------ADEYNRSPLHLAACR 206
Fly 207 GYIPIVQQLLKYGANPNVVDSLGNTPLHLAVISASSNNFNVVVGVLLQGGASVHMYDRSNKSPLE 271
Fly 272 LAEAKLRLLRNRYD 285 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10809 | NP_001163403.1 | Ank_2 | 167..263 | CDD:289560 | 33/102 (32%) |
ANK repeat | 167..193 | CDD:293786 | 9/32 (28%) | ||
ANK | 170..276 | CDD:238125 | 37/112 (33%) | ||
ANK repeat | 195..226 | CDD:293786 | 11/30 (37%) | ||
ANK repeat | 228..263 | CDD:293786 | 12/34 (35%) | ||
wtrw | NP_731193.1 | Ank_2 | 156..241 | CDD:289560 | 7/35 (20%) |
ANK repeat | 182..213 | CDD:293786 | 3/5 (60%) | ||
ANK repeat | 215..242 | CDD:293786 | 4/28 (14%) | ||
ANK | 216..341 | CDD:238125 | 28/129 (22%) | ||
ANK repeat | 250..281 | CDD:293786 | 4/30 (13%) | ||
Ank_2 | 255..351 | CDD:289560 | 26/98 (27%) | ||
ANK repeat | 283..317 | CDD:293786 | 11/36 (31%) | ||
ANK | 323..443 | CDD:238125 | 31/88 (35%) | ||
ANK repeat | 323..351 | CDD:293786 | 11/27 (41%) | ||
Ank_2 | 325..420 | CDD:289560 | 31/86 (36%) | ||
ANK repeat | 353..385 | CDD:293786 | 12/34 (35%) | ||
ANK repeat | 387..420 | CDD:293786 | 7/21 (33%) | ||
Ank_2 | 392..>460 | CDD:289560 | 6/16 (38%) | ||
ANK repeat | 422..452 | CDD:293786 | |||
Ion_trans | 613..812 | CDD:278921 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24197 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |