DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10809 and wtrw

DIOPT Version :9

Sequence 1:NP_001163403.1 Gene:CG10809 / 39159 FlyBaseID:FBgn0036052 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_731193.1 Gene:wtrw / 40931 FlyBaseID:FBgn0260005 Length:986 Species:Drosophila melanogaster


Alignment Length:209 Identity:55/209 - (26%)
Similarity:85/209 - (40%) Gaps:48/209 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 LNPNASNAEYLPSLIHPSTLPSGSKSFKM-------------RPRMQR-LKHSYSYSNII----- 159
            ||.|..:..|.|  :|.:...:.:::.|:             :|..:. |.|....||.:     
  Fly   207 LNVNLQSKCYTP--LHCAAFGNAAEAAKLLINNGADISKDTSKPNCEESLLHCAVRSNALECLQI 269

  Fly   160 ----------VQSNG-RKLRTAASTCNIELLNRILEGGANPNA-------ADEYNRSPLHLAACR 206
                      ::.|| ..:..||...||:.|..:|..   |||       ..|...:.|||||..
  Fly   270 FIAEGADVNSLKPNGTNAIHLAADLGNIQCLEALLNA---PNADANVRICIREKESTALHLAADE 331

  Fly   207 GYIPIVQQLLKYGANPNVVDSLGNTPLHLAVISASSNNFNVVVGVLLQGGASVHMYDRSNKSPLE 271
            |.:..|..||..||:..:.:..|.||||||   |.:::.:.|..:|..|.|..:..|..:::||.
  Fly   332 GNVECVDLLLAKGADAKLKNHRGFTPLHLA---ARTSSLDCVESLLRNGNADANAEDFDHRTPLH 393

  Fly   272 LAEAKLRLLRNRYD 285
            .|..|   ..|.||
  Fly   394 AAVGK---SENAYD 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10809NP_001163403.1 Ank_2 167..263 CDD:289560 33/102 (32%)
ANK repeat 167..193 CDD:293786 9/32 (28%)
ANK 170..276 CDD:238125 37/112 (33%)
ANK repeat 195..226 CDD:293786 11/30 (37%)
ANK repeat 228..263 CDD:293786 12/34 (35%)
wtrwNP_731193.1 Ank_2 156..241 CDD:289560 7/35 (20%)
ANK repeat 182..213 CDD:293786 3/5 (60%)
ANK repeat 215..242 CDD:293786 4/28 (14%)
ANK 216..341 CDD:238125 28/129 (22%)
ANK repeat 250..281 CDD:293786 4/30 (13%)
Ank_2 255..351 CDD:289560 26/98 (27%)
ANK repeat 283..317 CDD:293786 11/36 (31%)
ANK 323..443 CDD:238125 31/88 (35%)
ANK repeat 323..351 CDD:293786 11/27 (41%)
Ank_2 325..420 CDD:289560 31/86 (36%)
ANK repeat 353..385 CDD:293786 12/34 (35%)
ANK repeat 387..420 CDD:293786 7/21 (33%)
Ank_2 392..>460 CDD:289560 6/16 (38%)
ANK repeat 422..452 CDD:293786
Ion_trans 613..812 CDD:278921
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24197
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.