DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10809 and ankrd46b

DIOPT Version :9

Sequence 1:NP_001163403.1 Gene:CG10809 / 39159 FlyBaseID:FBgn0036052 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_991159.1 Gene:ankrd46b / 402888 ZFINID:ZDB-GENE-050114-7 Length:228 Species:Danio rerio


Alignment Length:193 Identity:53/193 - (27%)
Similarity:80/193 - (41%) Gaps:39/193 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 SYSYSNIIVQSNGRKLRTAASTCNIELLNRILEGGANPNAADEYNRSPLHLAACRGYIPIVQQLL 216
            ||.:.|...|::...|: |....::....|:||.|.:||..|...|:.|||||.||.:.|.:.|.
Zfish     2 SYVFINDSSQTSVPLLQ-ACIDGDLSFARRLLETGCDPNIRDHRGRTGLHLAAARGNVDICRFLH 65

  Fly   217 KYGANPNVVDSLGNTPLHLAVISASSNNFNVVVGVLLQGGASVHMYDRSNKSPLELAEAK----- 276
            |:||:....|..|||.|||.       .....:..|:..|..:.:.:.:..:||.||:.:     
Zfish    66 KFGADLLATDYQGNTALHLC-------GHVDTIQFLVSNGLKIDICNHNGSTPLVLAKRRGVNKD 123

  Fly   277 -LRLLR----------NRYDHPTPETAKILEDMCMLTTLILRYMVKQQRELEDLSALEKRLQN 328
             :|||.          ||..|...|..:               |.:.:..:|..|.|...|||
Zfish   124 AIRLLEGLEEQEVKGFNRGAHSKLEAMQ---------------MAESESAMESHSLLNPNLQN 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10809NP_001163403.1 Ank_2 167..263 CDD:289560 31/95 (33%)
ANK repeat 167..193 CDD:293786 8/25 (32%)
ANK 170..276 CDD:238125 34/105 (32%)
ANK repeat 195..226 CDD:293786 13/30 (43%)
ANK repeat 228..263 CDD:293786 8/34 (24%)
ankrd46bNP_991159.1 ANK 1 11..40 8/29 (28%)
ANK 15..128 CDD:238125 36/120 (30%)
ANK repeat 15..42 CDD:293786 8/27 (30%)
Ank_2 16..105 CDD:289560 31/96 (32%)
ANK repeat 44..75 CDD:293786 13/30 (43%)
ANK 2 44..73 13/28 (46%)
ANK repeat 77..105 CDD:293786 8/34 (24%)
ANK 3 77..103 8/32 (25%)
ANK 4 107..138 7/30 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.