DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10809 and Ankk1

DIOPT Version :9

Sequence 1:NP_001163403.1 Gene:CG10809 / 39159 FlyBaseID:FBgn0036052 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001102469.2 Gene:Ankk1 / 367080 RGDID:1305538 Length:784 Species:Rattus norvegicus


Alignment Length:219 Identity:60/219 - (27%)
Similarity:93/219 - (42%) Gaps:51/219 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 LSRDRGEHFALPH------LPPL-------PLNPNASNAEYLPSLIHPSTLPSGSKSFKMRPRMQ 147
            |:.::|:..|:.|      ||.:       ||:..|:..:||              .|||     
  Rat   552 LAVEKGKVRAIQHLLKRGALPDVLDHNGYSPLHIAAAKGKYL--------------IFKM----- 597

  Fly   148 RLKHSYSYSNIIVQSNGRKLRTAASTCNIELLNRILEGGANPNAADEYNRSPLHLAACRGYIPIV 212
            .|:|..|. .:..|.....|..|....::|:::.:.:..|:.:|......:||||||..|...::
  Rat   598 LLRHGASL-ELCTQQGWAPLHLATYKGHLEIIHLLAKSHADLDALGSMQWTPLHLAAFCGEEGMM 661

  Fly   213 QQLLKYGANPNVVDSLGNTPLHLAVISASSNNFNVVVGV--LLQGGASVHMYDRSNKSPLELAEA 275
            ..||:.|||||..:..|.|||||||      :....:|:  ||:.||.||..::...:|..||..
  Rat   662 LALLQCGANPNAAEQSGWTPLHLAV------HKGTFLGIVHLLEHGADVHACNKVGWTPAHLAAL 720

  Fly   276 KLRLLRNRYDHPTPETAKILEDMC 299
            |          ...|..|:|...|
  Rat   721 K----------GNTEILKVLVKAC 734

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10809NP_001163403.1 Ank_2 167..263 CDD:289560 34/97 (35%)
ANK repeat 167..193 CDD:293786 5/25 (20%)
ANK 170..276 CDD:238125 36/107 (34%)
ANK repeat 195..226 CDD:293786 14/30 (47%)
ANK repeat 228..263 CDD:293786 15/36 (42%)
Ankk1NP_001102469.2 PKc_like 37..305 CDD:389743
ANK repeat 383..411 CDD:293786
Ank_2 385..476 CDD:372319
ANK repeat 413..444 CDD:293786
PHA03095 432..>689 CDD:222980 45/162 (28%)
ANK repeat 446..477 CDD:293786
ANK repeat 479..510 CDD:293786
ANK repeat 512..542 CDD:293786
ANK repeat 547..576 CDD:293786 6/23 (26%)
ANK repeat 578..609 CDD:293786 11/50 (22%)
ANK repeat 612..642 CDD:293786 5/29 (17%)
ANK repeat 644..675 CDD:293786 14/30 (47%)
Ank_2 649..741 CDD:372319 36/102 (35%)
ANK repeat 677..708 CDD:293786 15/36 (42%)
ANK repeat 710..741 CDD:293786 8/35 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.