DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10809 and ANKDD1A

DIOPT Version :9

Sequence 1:NP_001163403.1 Gene:CG10809 / 39159 FlyBaseID:FBgn0036052 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_874362.3 Gene:ANKDD1A / 348094 HGNCID:28002 Length:522 Species:Homo sapiens


Alignment Length:259 Identity:67/259 - (25%)
Similarity:106/259 - (40%) Gaps:48/259 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 NASFQLSRDRGEHFALPHLPPLPLNPNASNAEYLPSL------IHPSTLPSGSKSFKMRPRMQRL 149
            |.:..|:..||....|..|..:.|:....|||.|.:|      .||..             :|.|
Human   193 NTALHLAAGRGHMAVLQRLVDIGLDLEEQNAEGLTALHSAAGGSHPDC-------------VQLL 244

  Fly   150 KHSYSYSNIIVQSNGRKLRTAASTCNIELLNRILEGGANPNAADEYNRSPLHLAACRGYIPIVQQ 214
            ..:.|..|.:.|.|...|..||.:.:.::...::..|...|..|....||||||....:..:|:.
Human   245 LRAGSTVNALTQKNLSCLHYAALSGSEDVSRVLIHAGGCANVVDHQGASPLHLAVRHNFPALVRL 309

  Fly   215 LLKYGANPNVVDSLGNTPLHLAVISASSNNFNVVVGVLLQGGASVHMYDRSNKSPLELA----EA 275
            |:...::.|.||:...|||||    |:.:.:..:..:||..|..:::.|:..|:.|.:|    ..
Human   310 LINSDSDVNAVDNRQQTPLHL----AAEHAWQDIADMLLIAGVDLNLRDKQGKTALAVAVRSNHV 370

  Fly   276 KL--------RLLRNRYDHPTPETAKIL---ED--------MCMLTTLILRYMVKQQRELEDLS 320
            .|        |..|...|||:..:.|.|   :|        ..:|..|..||:  |.||.:.|:
Human   371 SLVDMIIKADRFYRWEKDHPSDPSGKSLSFKQDHRQETQQLRSVLWRLASRYL--QPREWKKLA 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10809NP_001163403.1 Ank_2 167..263 CDD:289560 26/95 (27%)
ANK repeat 167..193 CDD:293786 5/25 (20%)
ANK 170..276 CDD:238125 29/109 (27%)
ANK repeat 195..226 CDD:293786 9/30 (30%)
ANK repeat 228..263 CDD:293786 9/34 (26%)
ANKDD1ANP_874362.3 ANK 1 14..43
Ank_2 19..118 CDD:289560
ANK repeat 19..45 CDD:293786
ANK 43..179 CDD:238125
ANK 2 47..76
ANK repeat 48..78 CDD:293786
ANK repeat 90..121 CDD:293786
ANK 3 90..119
Ank_2 95..189 CDD:289560
ANK 122..245 CDD:238125 15/64 (23%)
ANK repeat 123..156 CDD:293786
ANK 4 123..152
ANK 5 158..187
ANK repeat 159..189 CDD:293786
Ank_2 163..253 CDD:289560 17/72 (24%)
ANK 186..311 CDD:238125 33/130 (25%)
ANK repeat 191..222 CDD:293786 7/28 (25%)
ANK 6 191..220 7/26 (27%)
ANK repeat 224..253 CDD:293786 8/41 (20%)
ANK 7 224..253 8/41 (20%)
ANK 252..377 CDD:238125 34/128 (27%)
ANK 8 257..286 5/28 (18%)
ANK repeat 260..288 CDD:293786 5/27 (19%)
Ank_2 262..354 CDD:289560 26/95 (27%)
ANK repeat 290..321 CDD:293786 9/30 (30%)
ANK 9 290..319 8/28 (29%)
ANK repeat 323..354 CDD:293786 9/34 (26%)
ANK 10 323..352 9/32 (28%)
ANK 11 356..385 5/28 (18%)
Death 426..494 CDD:260017 3/7 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.