DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10809 and Ankk1

DIOPT Version :9

Sequence 1:NP_001163403.1 Gene:CG10809 / 39159 FlyBaseID:FBgn0036052 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001363880.1 Gene:Ankk1 / 244859 MGIID:3045301 Length:746 Species:Mus musculus


Alignment Length:226 Identity:59/226 - (26%)
Similarity:98/226 - (43%) Gaps:43/226 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 LSRDRGEHFALPHLPPLPLNPNA-SNAEYLPSLIHPSTLPSGSKSFKMRPRMQRLKHSYSYS-NI 158
            |:.:||:..|:.||......|:| .::.|.|  :|.:........|||..|       |..| .:
Mouse   542 LAVERGKVRAIQHLLKCGALPDALDHSGYSP--LHIAAARGKDLIFKMLLR-------YGASLEL 597

  Fly   159 IVQSNGRKLRTAASTCNIELLNRILEGGANPNAADEYNRSPLHLAACRGYIPIVQQLLKYGANPN 223
            ..|.....|..|....::|:::::.:...:.:|......:||||||.:|...::..||:.|||||
Mouse   598 RTQQGWTPLHLATYKGHLEIIHQLAKSHVDLDALGSMQWTPLHLAAFQGEEGVMLALLQCGANPN 662

  Fly   224 VVDSLGNTPLHLAVISASSNNFNVVVGV--LLQGGASVHMYDRSNKSPLELAEAKLRLLRNRYDH 286
            ..:..|.|||||||      :....:|:  ||:.||.:|..::...:|..||..|          
Mouse   663 AAEQSGWTPLHLAV------HKGTFLGITHLLEYGADIHACNKVGWTPAHLAALK---------- 711

  Fly   287 PTPETAKILEDMCMLTTLILRYMVKQQRELE 317
                          ..|.||:.:||...:::
Mouse   712 --------------GNTAILKVLVKAAAQVD 728

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10809NP_001163403.1 Ank_2 167..263 CDD:289560 32/97 (33%)
ANK repeat 167..193 CDD:293786 4/25 (16%)
ANK 170..276 CDD:238125 34/107 (32%)
ANK repeat 195..226 CDD:293786 14/30 (47%)
ANK repeat 228..263 CDD:293786 14/36 (39%)
Ankk1NP_001363880.1 PKc_like 37..305 CDD:389743
PHA02876 <364..>694 CDD:165207 49/166 (30%)
ANK 1 370..399
ANK repeat 373..401 CDD:293786
ANK repeat 403..434 CDD:293786
ANK 2 403..432
ANK repeat 436..467 CDD:293786
ANK 3 436..465
ANK 4 469..498
ANK repeat 469..497 CDD:293786
ANK repeat 502..532 CDD:293786
ANK 5 502..531
ANK 6 535..564 7/21 (33%)
ANK repeat 537..566 CDD:293786 8/23 (35%)
ANK repeat 568..599 CDD:293786 9/39 (23%)
ANK 7 568..597 9/37 (24%)
ANK 8 601..630 3/28 (11%)
ANK repeat 602..632 CDD:293786 4/29 (14%)
ANK repeat 634..665 CDD:293786 14/30 (47%)
ANK 9 634..663 13/28 (46%)
ANK repeat 667..698 CDD:293786 14/36 (39%)
ANK 10 667..696 13/34 (38%)
Ank_2 672..>742 CDD:372319 20/87 (23%)
ANK repeat 700..730 CDD:293786 9/53 (17%)
ANK 11 700..729 9/53 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.