DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10809 and ZDHHC17

DIOPT Version :10

Sequence 1:NP_648365.1 Gene:CG10809 / 39159 FlyBaseID:FBgn0036052 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_056151.2 Gene:ZDHHC17 / 23390 HGNCID:18412 Length:632 Species:Homo sapiens


Alignment Length:111 Identity:35/111 - (31%)
Similarity:59/111 - (53%) Gaps:5/111 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 QSNGRKLRTAASTCNIELLNRILEGGA-NPNAADEYNRSPLHLAACRGYIPIVQQLLKYGANPNV 224
            :.|...|..||....|:|:...:..|| ......:.|.:|||.|..:|::.:|.||:||||:|::
Human    88 KENVTLLHWAAINNRIDLVKYYISKGAIVDQLGGDLNSTPLHWATRQGHLSMVVQLMKYGADPSL 152

  Fly   225 VDSLGNTPLHLAVISASSNNFNVVVGVLLQGGASVHMYDRSNKSPL 270
            :|..|.:.:|||.....::    :|..|:..|..|.|.|::..:||
Human   153 IDGEGCSCIHLAAQFGHTS----IVAYLIAKGQDVDMMDQNGMTPL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10809NP_648365.1 ANKYR <167..>278 CDD:440430 34/105 (32%)
ANK repeat 167..193 CDD:293786 7/26 (27%)
ANK repeat 195..226 CDD:293786 14/30 (47%)
ANK repeat 228..263 CDD:293786 9/34 (26%)
ZDHHC17NP_056151.2 Necessary and sufficient for interaction with DNAJC5 and SNAP25. /evidence=ECO:0000250|UniProtKB:Q80TN5 11..305 35/111 (32%)
ANKYR 52..307 CDD:440430 35/111 (32%)
ANK repeat 89..120 CDD:293786 8/30 (27%)
ANK repeat 122..154 CDD:293786 14/31 (45%)
ANK repeat 156..187 CDD:293786 9/34 (26%)
ANK repeat 189..221 CDD:293786 2/6 (33%)
ANK repeat 224..255 CDD:293786
DHHC 438..568 CDD:396215
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.