DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10809 and ZDHHC17

DIOPT Version :9

Sequence 1:	NP_001163403.1	Gene:	CG10809 / 39159	FlyBaseID:	FBgn0036052	Length:	358	Species:	Drosophila melanogaster
Sequence 2:	NP_056151.2	Gene:	ZDHHC17 / 23390	HGNCID:	18412	Length:	632	Species:	Homo sapiens

Alignment Length:	111	Identity:	35/111 - (31%)
Similarity:	59/111 - (53%)	Gaps:	5/111 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly   161 QSNGRKLRTAASTCNIELLNRILEGGA-NPNAADEYNRSPLHLAACRGYIPIVQQLLKYGANPNV 224
            :.|...|..||....|:|:...:..|| ......:.|.:|||.|..:|::.:|.||:||||:|::
Human    88 KENVTLLHWAAINNRIDLVKYYISKGAIVDQLGGDLNSTPLHWATRQGHLSMVVQLMKYGADPSL 152

  Fly   225 VDSLGNTPLHLAVISASSNNFNVVVGVLLQGGASVHMYDRSNKSPL 270
            :|..|.:.:|||.....::    :|..|:..|..|.|.|::..:||
Human   153 IDGEGCSCIHLAAQFGHTS----IVAYLIAKGQDVDMMDQNGMTPL 194

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10809	NP_001163403.1	Ank_2	167..263	CDD:289560	31/96 (32%)
		ANK repeat	167..193	CDD:293786	7/26 (27%)
		ANK	170..276	CDD:238125	33/102 (32%)
		ANK repeat	195..226	CDD:293786	14/30 (47%)
		ANK repeat	228..263	CDD:293786	9/34 (26%)
ZDHHC17	NP_056151.2	Necessary and sufficient for interaction with DNAJC5 and SNAP25. /evidence=ECO:0000250\|UniProtKB:Q80TN5	11..305		35/111 (32%)
		ANK repeat	89..120	CDD:293786	8/30 (27%)
		Ank_2	94..187	CDD:403870	31/96 (32%)
		ANK repeat	122..154	CDD:293786	14/31 (45%)
		ANK repeat	156..187	CDD:293786	9/34 (26%)
		Ank_2	161..255	CDD:403870	11/38 (29%)
		ANK repeat	189..221	CDD:293786	2/6 (33%)
		ANK repeat	224..255	CDD:293786
		Ank_2	229..>286	CDD:423045
		DHHC	438..568	CDD:396215
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910