DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10809 and C01G10.1

DIOPT Version :9

Sequence 1:NP_001163403.1 Gene:CG10809 / 39159 FlyBaseID:FBgn0036052 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_506722.2 Gene:C01G10.1 / 180019 WormBaseID:WBGene00007230 Length:1213 Species:Caenorhabditis elegans


Alignment Length:127 Identity:25/127 - (19%)
Similarity:54/127 - (42%) Gaps:7/127 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 KHSYSYSNIIVQSNGRK-LRTAASTCNIELLNRILEGGANPNAADEYNRSPLHLAACRGYIPIVQ 213
            ::.:.||..:...:|:. |..|....|.......::.|:..||.:::..:.||.|.......||:
 Worm   861 ENRWRYSLFLDNQDGKNTLLDAVREINKTNAVNAVKAGSYINAFNKFGNTALHTATKSALPEIVK 925

  Fly   214 QLLKYGANPNVVDSLGNTP------LHLAVISASSNNFNVVVGVLLQGGASVHMYDRSNKSP 269
            .|:|.||:..:::::..||      ::..:......||:.:..:..:.....|..:...|.|
 Worm   926 LLIKNGADRELLNTMNRTPEQMIPLVYKDIPKDKVENFDKIRALYKKANGKKHKMNVPQKFP 987

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10809NP_001163403.1 Ank_2 167..263 CDD:289560 20/101 (20%)
ANK repeat 167..193 CDD:293786 6/25 (24%)
ANK 170..276 CDD:238125 21/106 (20%)
ANK repeat 195..226 CDD:293786 9/30 (30%)
ANK repeat 228..263 CDD:293786 5/40 (13%)
C01G10.1NP_506722.2 WSN 23..91 CDD:197734
ANK <872..944 CDD:238125 16/71 (23%)
ANK repeat 907..938 CDD:293786 9/30 (30%)
BRCT 991..1063 CDD:214602
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1559479at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.