DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10809 and trpa-1

DIOPT Version :9

Sequence 1:NP_001163403.1 Gene:CG10809 / 39159 FlyBaseID:FBgn0036052 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_502249.3 Gene:trpa-1 / 178118 WormBaseID:WBGene00007801 Length:1211 Species:Caenorhabditis elegans


Alignment Length:329 Identity:76/329 - (23%)
Similarity:123/329 - (37%) Gaps:69/329 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 TPTSSPNTHGEWPHMN--INLNLNMSS-NPSTNASFQLSRDRGE----HFALPHLPPLPLNP-NA 118
            ||......||....:.  |..|.|::. :...|..|.:...|||    ...:.|.|...:.. |.
 Worm   209 TPLLLACVHGSQEIIQELIKANSNVTKRDQRLNTVFHIVALRGEPEYLEMMMDHDPVEAIKALNL 273

  Fly   119 SNAEYLPSL------IHPSTLP-----SGSKSFKMRPRMQRLKHSYSYSNIIVQSNGRKLRTAAS 172
            .|.|....|      .||.||.     ....|.|...|.:.|.|                 .||.
 Worm   274 FNNEKKTPLRMAVEGNHPETLKKILQMEKKNSCKWMDREKELIH-----------------FAAE 321

  Fly   173 TCNIELLNRILEGGANPNAADEYNRSPLHLAACRGYIPIVQQLLKYGA-NPNVVDSLGNTPLHLA 236
            ...:|:|..::|.|.|.|..:|....|||:||....:.:|..|::... |.:|||..|.|||.:|
 Worm   322 KGFLEVLKALVEAGGNKNELNEVKAVPLHVAAQMNQLEVVSYLIEEEKDNIDVVDEQGLTPLMMA 386

  Fly   237 VISASSNNFNVVVGVLLQGGASVHMYDRSNKSPLELAEAKLRLL------------------RNR 283
            |...|..    .|..|:...|::.:.|:..::|:.:. ||...|                  |:.
 Worm   387 VTHDSKK----CVEYLIAKKANLTITDKDERTPVFIG-AKFNALSSVEYILDHLRKKNKETERSA 446

  Fly   284 YDHPTPETAKILEDMCMLTTLIL--------RYMVKQQRELEDLSALEKRLQNLS-TSDDQEQVV 339
            ...||..|.:|:.:....|.:.:        .::|.....||.:..|:|...::: .::|:|..:
 Worm   447 LKSPTRNTLRIVSEDVRRTMVNMVDRDQNTPMHIVASNGYLEMMQLLQKHGASITQVNEDEETAL 511

  Fly   340 SQTA 343
            .:.|
 Worm   512 HRAA 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10809NP_001163403.1 Ank_2 167..263 CDD:289560 30/96 (31%)
ANK repeat 167..193 CDD:293786 8/25 (32%)
ANK 170..276 CDD:238125 32/106 (30%)
ANK repeat 195..226 CDD:293786 9/31 (29%)
ANK repeat 228..263 CDD:293786 10/34 (29%)
trpa-1NP_502249.3 Ank_4 51..104 CDD:290365
ANK repeat 51..81 CDD:293786
ANK 78..227 CDD:238125 4/17 (24%)
ANK repeat 86..114 CDD:293786
Ank_2 88..204 CDD:289560
ANK repeat 116..171 CDD:293786
ANK 168..298 CDD:238125 22/88 (25%)
ANK repeat 173..204 CDD:293786
ANK repeat 206..237 CDD:293786 7/27 (26%)
Ank_4 208..258 CDD:290365 12/48 (25%)
Ank_2 244..342 CDD:289560 27/114 (24%)
ANK repeat 280..310 CDD:293786 7/29 (24%)
Ank_2 316..409 CDD:289560 31/113 (27%)
ANK repeat 316..342 CDD:293786 9/42 (21%)
ANK 339..493 CDD:238125 37/158 (23%)
ANK repeat 344..376 CDD:293786 9/31 (29%)
ANK repeat 378..409 CDD:293786 10/34 (29%)
Ank_2 383..504 CDD:289560 23/125 (18%)
ANK 468..594 CDD:238125 8/48 (17%)
ANK repeat 473..504 CDD:293786 5/30 (17%)
Ank_2 479..571 CDD:289560 8/37 (22%)
ANK repeat 506..538 CDD:293786 3/10 (30%)
ANK 536..659 CDD:238125
ANK repeat 540..571 CDD:293786
Ank_2 545..636 CDD:289560
ANK repeat 573..601 CDD:293786
ANK repeat 605..636 CDD:293786
Ion_trans 857..1080 CDD:278921
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24197
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.