DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10809 and unc-44

DIOPT Version :9

Sequence 1:NP_001163403.1 Gene:CG10809 / 39159 FlyBaseID:FBgn0036052 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001367345.1 Gene:unc-44 / 177366 WormBaseID:WBGene00006780 Length:6994 Species:Caenorhabditis elegans


Alignment Length:212 Identity:58/212 - (27%)
Similarity:89/212 - (41%) Gaps:55/212 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LNMSSNPSTNASFQLSRDRGEHFALPHLPPLPLNPNASNAEYLPSLIHPSTLPSGSKSFKMRPRM 146
            |...:||.....      |||       .||.|...|:..:.:..||.     :|:|        
 Worm   445 LQQGANPDVETV------RGE-------TPLHLAARANQTDVVRVLIR-----NGAK-------- 483

  Fly   147 QRLKHSYSYSNIIVQSNGRKLRT----AASTCNIELLNRILEGGANPNAADEYNRSPLHLAACRG 207
                         |.:..|:|:|    |:...|.:::..:|:.|||.||....|.||||:||..|
 Worm   484 -------------VDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEG 535

  Fly   208 YIPIVQQLLKYGANPNVVDSLGNTPLHLAVISASSNNFNV-VVGVLLQGGASVHMYDRSNKSPLE 271
            ...:...||.:.|:..::...|.||||||     |...|: ||.:||:.|..|.:..::..:||.
 Worm   536 QEEVAGILLDHNADKTLLTKKGFTPLHLA-----SKYGNLEVVRLLLERGTPVDIEGKNQVTPLH 595

  Fly   272 LA------EAKLRLLRN 282
            :|      :..:.||.|
 Worm   596 VAAHYNNDKVAMLLLEN 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10809NP_001163403.1 Ank_2 167..263 CDD:289560 36/100 (36%)
ANK repeat 167..193 CDD:293786 10/29 (34%)
ANK 170..276 CDD:238125 37/112 (33%)
ANK repeat 195..226 CDD:293786 11/30 (37%)
ANK repeat 228..263 CDD:293786 15/35 (43%)
unc-44NP_001367345.1 ANK repeat 32..63 CDD:293786
PHA03095 37..>387 CDD:222980
ANK repeat 65..96 CDD:293786
ANK repeat 98..129 CDD:293786
ANK repeat 131..156 CDD:293786
ANK repeat 197..224 CDD:293786
ANK repeat 226..257 CDD:293786
PHA02876 <242..>648 CDD:165207 58/212 (27%)
ANK repeat 259..290 CDD:293786
ANK repeat 292..322 CDD:293786
ANK repeat 325..356 CDD:293786
ANK repeat 358..389 CDD:293786
ANK repeat 391..422 CDD:293786
ANK repeat 424..455 CDD:293786 3/9 (33%)
ANK repeat 457..488 CDD:293786 12/63 (19%)
ANK repeat 490..519 CDD:293786 8/28 (29%)
ANK repeat 523..552 CDD:293786 11/28 (39%)
Ank_2 555..>780 CDD:423045 21/63 (33%)
ANK repeat 556..586 CDD:293786 15/34 (44%)
ANK repeat 589..620 CDD:293786 6/24 (25%)
ANK repeat 622..652 CDD:293786
ANK repeat 655..685 CDD:293786
ANK repeat 688..719 CDD:293786
ANK repeat 721..752 CDD:293786
ANK repeat 754..784 CDD:293786
Ank_4 756..807 CDD:372654
ZU5 1008..1110 CDD:128514
UPA_2 1337..1472 CDD:375346
Death_ank 1503..1580 CDD:260029
PTZ00449 <1770..2112 CDD:185628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.