Sequence 1: | NP_001163403.1 | Gene: | CG10809 / 39159 | FlyBaseID: | FBgn0036052 | Length: | 358 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001367345.1 | Gene: | unc-44 / 177366 | WormBaseID: | WBGene00006780 | Length: | 6994 | Species: | Caenorhabditis elegans |
Alignment Length: | 212 | Identity: | 58/212 - (27%) |
---|---|---|---|
Similarity: | 89/212 - (41%) | Gaps: | 55/212 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 82 LNMSSNPSTNASFQLSRDRGEHFALPHLPPLPLNPNASNAEYLPSLIHPSTLPSGSKSFKMRPRM 146
Fly 147 QRLKHSYSYSNIIVQSNGRKLRT----AASTCNIELLNRILEGGANPNAADEYNRSPLHLAACRG 207
Fly 208 YIPIVQQLLKYGANPNVVDSLGNTPLHLAVISASSNNFNV-VVGVLLQGGASVHMYDRSNKSPLE 271
Fly 272 LA------EAKLRLLRN 282 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10809 | NP_001163403.1 | Ank_2 | 167..263 | CDD:289560 | 36/100 (36%) |
ANK repeat | 167..193 | CDD:293786 | 10/29 (34%) | ||
ANK | 170..276 | CDD:238125 | 37/112 (33%) | ||
ANK repeat | 195..226 | CDD:293786 | 11/30 (37%) | ||
ANK repeat | 228..263 | CDD:293786 | 15/35 (43%) | ||
unc-44 | NP_001367345.1 | ANK repeat | 32..63 | CDD:293786 | |
PHA03095 | 37..>387 | CDD:222980 | |||
ANK repeat | 65..96 | CDD:293786 | |||
ANK repeat | 98..129 | CDD:293786 | |||
ANK repeat | 131..156 | CDD:293786 | |||
ANK repeat | 197..224 | CDD:293786 | |||
ANK repeat | 226..257 | CDD:293786 | |||
PHA02876 | <242..>648 | CDD:165207 | 58/212 (27%) | ||
ANK repeat | 259..290 | CDD:293786 | |||
ANK repeat | 292..322 | CDD:293786 | |||
ANK repeat | 325..356 | CDD:293786 | |||
ANK repeat | 358..389 | CDD:293786 | |||
ANK repeat | 391..422 | CDD:293786 | |||
ANK repeat | 424..455 | CDD:293786 | 3/9 (33%) | ||
ANK repeat | 457..488 | CDD:293786 | 12/63 (19%) | ||
ANK repeat | 490..519 | CDD:293786 | 8/28 (29%) | ||
ANK repeat | 523..552 | CDD:293786 | 11/28 (39%) | ||
Ank_2 | 555..>780 | CDD:423045 | 21/63 (33%) | ||
ANK repeat | 556..586 | CDD:293786 | 15/34 (44%) | ||
ANK repeat | 589..620 | CDD:293786 | 6/24 (25%) | ||
ANK repeat | 622..652 | CDD:293786 | |||
ANK repeat | 655..685 | CDD:293786 | |||
ANK repeat | 688..719 | CDD:293786 | |||
ANK repeat | 721..752 | CDD:293786 | |||
ANK repeat | 754..784 | CDD:293786 | |||
Ank_4 | 756..807 | CDD:372654 | |||
ZU5 | 1008..1110 | CDD:128514 | |||
UPA_2 | 1337..1472 | CDD:375346 | |||
Death_ank | 1503..1580 | CDD:260029 | |||
PTZ00449 | <1770..2112 | CDD:185628 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |