DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10809 and C18H2.5

DIOPT Version :9

Sequence 1:NP_001163403.1 Gene:CG10809 / 39159 FlyBaseID:FBgn0036052 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_741231.2 Gene:C18H2.5 / 176082 WormBaseID:WBGene00015992 Length:1195 Species:Caenorhabditis elegans


Alignment Length:174 Identity:45/174 - (25%)
Similarity:74/174 - (42%) Gaps:40/174 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 NRILEGGANPNAADEYNRSPLHLAACRGYIPIVQQLLKYGANPNVVDSLGNTPLHLAVISASSNN 244
            |.:||      |..|.|.:  ::|.|          :|.||..|..:..|||.|||    |:...
 Worm   858 NSLLE------AVREVNLT--NVANC----------VKKGAFINAYNRHGNTALHL----ATKRL 900

  Fly   245 FNVVVGVLLQGGASVHMYDRSNKSPLELAEAKLRLLRNRYDHPTPETAKILEDMCMLTTLILRYM 309
            :..:|.:|::.||...:.:..||.|.|:....|.:||      ..:.|||.:    :..:.|:|.
 Worm   901 YPDIVEILIKNGADRTLLNVQNKKPEEIIGTDLDVLR------ADQKAKIEK----IKNIYLKYQ 955

  Fly   310 VKQQR----ELEDLSAL----EKRLQNLSTSDDQEQVVSQTADE 345
            .|:.|    ||..:|:.    :|...:..|:...|...|..::|
 Worm   956 NKKFRIRVPELFPVSSFHIYADKSTDDKLTNQFMEVFKSIASNE 999

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10809NP_001163403.1 Ank_2 167..263 CDD:289560 23/82 (28%)
ANK repeat 167..193 CDD:293786 4/12 (33%)
ANK 170..276 CDD:238125 27/95 (28%)
ANK repeat 195..226 CDD:293786 7/30 (23%)
ANK repeat 228..263 CDD:293786 11/34 (32%)
C18H2.5NP_741231.2 WSN 40..108 CDD:197734
Ank_4 856..909 CDD:290365 20/72 (28%)
ANK 860..>924 CDD:238125 23/85 (27%)
ANK repeat 860..886 CDD:293786 11/43 (26%)
ANK repeat 888..922 CDD:293786 11/37 (30%)
BRCT 964..1044 CDD:214602 8/36 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1559479at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.