Sequence 1: | NP_001163403.1 | Gene: | CG10809 / 39159 | FlyBaseID: | FBgn0036052 | Length: | 358 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_498471.1 | Gene: | F37A4.4 / 175945 | WormBaseID: | WBGene00018134 | Length: | 1163 | Species: | Caenorhabditis elegans |
Alignment Length: | 206 | Identity: | 43/206 - (20%) |
---|---|---|---|
Similarity: | 80/206 - (38%) | Gaps: | 61/206 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 153 YSYSNIIVQSNGRK-LRTAASTCNIELLNRILEGGANPNAADEYNRSPLHLAACRGYIPIVQQLL 216
Fly 217 KYGANPNVVDSLGNTPLHLAVISASSNNFNVVVGVLLQGGASVHMYDRSNKSPLELAEAKLRLLR 281
Fly 282 NRY---------------------------DHPTPE-TAK---ILEDMCMLTTLILRYMVKQQR- 314
Fly 315 ---ELEDLSAL 322 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10809 | NP_001163403.1 | Ank_2 | 167..263 | CDD:289560 | 19/95 (20%) |
ANK repeat | 167..193 | CDD:293786 | 6/25 (24%) | ||
ANK | 170..276 | CDD:238125 | 21/105 (20%) | ||
ANK repeat | 195..226 | CDD:293786 | 12/30 (40%) | ||
ANK repeat | 228..263 | CDD:293786 | 1/34 (3%) | ||
F37A4.4 | NP_498471.1 | WSN | 27..95 | CDD:197734 | |
Ank_2 | 844..>893 | CDD:289560 | 15/48 (31%) | ||
ANK | <844..893 | CDD:238125 | 15/48 (31%) | ||
ANK repeat | 856..887 | CDD:293786 | 12/30 (40%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1559479at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |