DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10809 and ANKRD54

DIOPT Version :9

Sequence 1:NP_001163403.1 Gene:CG10809 / 39159 FlyBaseID:FBgn0036052 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_011528179.1 Gene:ANKRD54 / 129138 HGNCID:25185 Length:344 Species:Homo sapiens


Alignment Length:240 Identity:62/240 - (25%)
Similarity:106/240 - (44%) Gaps:64/240 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 RKLRTAASTCNIELLNRILEGGANPNAADEYNRSPLHLAACRGYIPIVQQLLKYGANPN------ 223
            ::||.:|:..::|.:.::||.||:|.|||:..|:.||.|:|.|...|.|:.|...:.|.      
Human   112 KRLRDSANANDVETVQQLLEDGADPCAADDKGRTALHFASCNGNDQIGQEALPKSSVPGPQGFAH 176

  Fly   224 -----------VVDSLGNTPLHL------AVISASSNNFNVVVGV-----------------LLQ 254
                       :...:|....|.      ....:|.:.:..|.|.                 |:.
Human   177 ELCCSWTMVLILTSEMGWGTRHCTWRPAPTTFLSSPHCYEEVCGFFPSLSSFSPSPPECSPQLVP 241

  Fly   255 GGASVHMYDRSNKSPLELAEAKLRLLRNRYDHPTPETAKILE----DMCMLTTLILRYMVK---- 311
            .||.|...||:.::||.||::||.:|:..:       |:.||    ::..:..::..|:.:    
Human   242 AGARVDALDRAGRTPLHLAKSKLNILQEGH-------AQCLEAVRLEVKQIIHMLREYLERLGQH 299

  Fly   312 QQRE-LEDLSALEKRLQNLSTSDDQEQVVSQTADELLASVERLSI 355
            :||| |:||..   |||..||.:..::|.     :||||...||:
Human   300 EQRERLDDLCT---RLQMTSTKEQVDEVT-----DLLASFTSLSL 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10809NP_001163403.1 Ank_2 167..263 CDD:289560 31/135 (23%)
ANK repeat 167..193 CDD:293786 10/25 (40%)
ANK 170..276 CDD:238125 35/145 (24%)
ANK repeat 195..226 CDD:293786 10/47 (21%)
ANK repeat 228..263 CDD:293786 9/57 (16%)
ANKRD54XP_011528179.1 ANK 118..276 CDD:238125 39/164 (24%)
Ank_2 118..>174 CDD:289560 20/55 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BJ6N
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I4877
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1559479at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto88769
orthoMCL 1 0.900 - - OOG6_108203
Panther 1 1.100 - - LDO PTHR24197
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.