DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10809 and Ankrd28

DIOPT Version :9

Sequence 1:NP_001163403.1 Gene:CG10809 / 39159 FlyBaseID:FBgn0036052 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_006518432.1 Gene:Ankrd28 / 105522 MGIID:2145661 Length:1083 Species:Mus musculus


Alignment Length:168 Identity:52/168 - (30%)
Similarity:80/168 - (47%) Gaps:13/168 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LPPLPLNPNASNAEYLPSLIHPSTLPSGSKSFKMRPRMQRLKHSYSYS-NIIVQSNGRKLRTAAS 172
            |.||..|.|.|:.....:|.|        .:|.....|.:|..|...: |...:.:.|.:..||.
Mouse   156 LVPLLSNVNVSDRAGRTALHH--------AAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAY 212

  Fly   173 TCNIELLNRILEGGANPNAADEYNRSPLHLAACRGYIPIVQQLLKYGANPNVVDSLGNTPLHLAV 237
            ..:||::..::..||.....|:.:.:|||.||..|.|.:|:.||..|.:.|..::.||||||:|.
Mouse   213 MGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVAC 277

  Fly   238 ISASSNNFNVVVGVLLQGGASVHMYDRSNKSPLELAEA 275
            .    |..:|||..|:..||:|:..:....:||..|.|
Mouse   278 Y----NGQDVVVNELIDCGANVNQKNEKGFTPLHFAAA 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10809NP_001163403.1 Ank_2 167..263 CDD:289560 34/95 (36%)
ANK repeat 167..193 CDD:293786 6/25 (24%)
ANK 170..276 CDD:238125 38/106 (36%)
ANK repeat 195..226 CDD:293786 12/30 (40%)
ANK repeat 228..263 CDD:293786 15/34 (44%)
Ankrd28XP_006518432.1 ANK repeat 42..68 CDD:293786
Ank_2 53..>331 CDD:393464 52/168 (31%)
ANK repeat 70..101 CDD:293786
ANK repeat 106..134 CDD:293786
ANK repeat 136..167 CDD:293786 5/10 (50%)
ANK repeat 170..200 CDD:293786 7/37 (19%)
ANK repeat 202..233 CDD:293786 7/30 (23%)
PHA03095 216..>484 CDD:222980 36/100 (36%)
ANK repeat 235..266 CDD:293786 12/30 (40%)
ANK repeat 268..299 CDD:293786 15/34 (44%)
ANK repeat 301..332 CDD:293786 4/11 (36%)
ANK repeat 335..366 CDD:293786
ANK repeat 368..393 CDD:293786
ANK repeat 401..432 CDD:293786
ANK repeat 434..465 CDD:293786
ANK repeat 467..498 CDD:293786
ANK repeat 500..532 CDD:293786
Ank_2 505..610 CDD:372319
ANK repeat 582..610 CDD:293786
PHA02874 584..>893 CDD:165205
ANK repeat 612..643 CDD:293786
ANK repeat 648..680 CDD:293786
ANK repeat 682..713 CDD:293786
ANK repeat 715..746 CDD:293786
ANK repeat 748..777 CDD:293786
ANK repeat 819..850 CDD:293786
ANK repeat 853..883 CDD:293786
Ank_2 857..950 CDD:372319
ANK repeat 885..917 CDD:293786
ANK repeat 919..950 CDD:293786
ANK repeat 955..986 CDD:293786
Ank 957..987 CDD:365815
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.