DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10809 and LOC102552223

DIOPT Version :9

Sequence 1:NP_001163403.1 Gene:CG10809 / 39159 FlyBaseID:FBgn0036052 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_038950973.1 Gene:LOC102552223 / 102552223 RGDID:7638512 Length:283 Species:Rattus norvegicus


Alignment Length:131 Identity:29/131 - (22%)
Similarity:46/131 - (35%) Gaps:31/131 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 SYSNIIVQSNGRKLRTAASTCNIELLNRILEGGANPNAADEYNRSPLHLAACRGYIPIVQQLLKY 218
            |.||:..:::.|.|:.                 ..|:.|    |:.||.|:...:..:|..||:.
  Rat    22 SVSNLSTRAHRRHLKQ-----------------MTPSLA----RTSLHYASAHNHPDVVTLLLEN 65

  Fly   219 GANPNVVD--------SLGNTPLHLAVISASSNNFNVVVGVLLQGGASVHMYDRSNKSPLELAEA 275
            .:|.|:.|        ..|.|||.||.....:...|.:..  :...|.......|.:.|....|.
  Rat    66 KSNINIQDDEGCTPLIKYGLTPLQLATYENQTEMINFLES--MSADAQAVQVSNSARRPAHKKEV 128

  Fly   276 K 276
            |
  Rat   129 K 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10809NP_001163403.1 Ank_2 167..263 CDD:289560 21/103 (20%)
ANK repeat 167..193 CDD:293786 2/25 (8%)
ANK 170..276 CDD:238125 23/113 (20%)
ANK repeat 195..226 CDD:293786 9/30 (30%)
ANK repeat 228..263 CDD:293786 8/34 (24%)
LOC102552223XP_038950973.1 ANKYR 10..>124 CDD:223738 27/124 (22%)
ANK repeat 44..73 CDD:293786 9/28 (32%)
Ank_2 47..103 CDD:403870 16/55 (29%)
ANK repeat 75..113 CDD:293786 8/39 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1559479at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.