DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10809 and LOC101732478

DIOPT Version :9

Sequence 1:NP_001163403.1 Gene:CG10809 / 39159 FlyBaseID:FBgn0036052 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_004914495.1 Gene:LOC101732478 / 101732478 -ID:- Length:417 Species:Xenopus tropicalis


Alignment Length:260 Identity:66/260 - (25%)
Similarity:111/260 - (42%) Gaps:49/260 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 STNASFQLSRDRG--EHFALPHLPPLPLNPNASNAEYLPSLIHPSTLPSGSKSFKMRPRMQRLKH 151
            |.:.|.:|.|..|  :.:.|...|||           ..|:.|  :|.:...|.....|...:..
 Frog    24 SLSKSERLIRRTGRLKQWQLDRFPPL-----------CSSVTH--SLENKKTSLHEAVRRGDMDQ 75

  Fly   152 SYSYSNIIVQSN-----GRKLRTAASTC-NIELLNRILEGGANPNAADEYNRSPLHLAACRGYIP 210
            ..:..|..:..|     |..|..:|:.| ::.|:..:|:.||:.|..|..:.:|||.||..|:..
 Frog    76 VNTLLNFGIAVNCQDYRGWSLLHSAAFCGDLALVKYLLQKGASVNLRDVRSYTPLHRAAWTGHAE 140

  Fly   211 IVQQLLKYGANPNVVDSLGNTPLHLAVISASSNNFNVVVGVLLQGGASVHMYDRSNKSPLELAEA 275
            :...||:.||.|::|:..|.|||||    |::|...:.|.:|:|..||:.:.|.:..:||:... 
 Frog   141 LTDYLLQCGALPDIVNYCGETPLHL----AAANGHLLCVKILIQNKASIDIKDNNKWTPLQWCS- 200

  Fly   276 KLRLLRNRYDHPTPETAKILEDMCMLTTLILRYMVKQQRELEDLSALEKRLQNLSTSDDQEQVVS 340
                :.::.|                   :|.|:|.....||:.|.....|.:||......||::
 Frog   201 ----INDQID-------------------VLEYLVSLGASLEEKSTTGMTLLHLSALAGNLQVIN 242

  Fly   341  340
             Frog   243  242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10809NP_001163403.1 Ank_2 167..263 CDD:289560 34/96 (35%)
ANK repeat 167..193 CDD:293786 8/26 (31%)
ANK 170..276 CDD:238125 36/106 (34%)
ANK repeat 195..226 CDD:293786 11/30 (37%)
ANK repeat 228..263 CDD:293786 13/34 (38%)
LOC101732478XP_004914495.1 Ank_4 62..113 CDD:372654 9/50 (18%)
ANK repeat 62..90 CDD:293786 4/27 (15%)
ANK repeat 92..123 CDD:293786 9/30 (30%)
PHA03095 105..>375 CDD:222980 46/166 (28%)
ANK repeat 125..156 CDD:293786 11/30 (37%)
ANK repeat 158..189 CDD:293786 13/34 (38%)
ANK repeat 191..219 CDD:293786 6/51 (12%)
ANK repeat 227..255 CDD:293786 5/16 (31%)
ANK repeat 257..288 CDD:293786
ANK repeat 290..321 CDD:293786
ANK repeat 323..354 CDD:293786
ANK repeat 356..387 CDD:293786
Ank_4 359..407 CDD:372654
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.