DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10809 and ANKRD61

DIOPT Version :9

Sequence 1:NP_001163403.1 Gene:CG10809 / 39159 FlyBaseID:FBgn0036052 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001258629.1 Gene:ANKRD61 / 100310846 HGNCID:22467 Length:418 Species:Homo sapiens


Alignment Length:387 Identity:81/387 - (20%)
Similarity:145/387 - (37%) Gaps:135/387 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VLAKSTPMP-----MPTSASKGIMITPPPPAMPPTPTSSPN----------THGEWPHMN----- 77
            ||.::.|:.     :|.|||..:::|.|..::.|...::..          .||..|.:.     
Human    46 VLLRNHPVNQPITILPNSASNRLLLTQPTESIIPIHLAAKYHKAQSLLCLLRHGADPEVRDTTGL 110

  Fly    78 INLNLNMSSNPSTNASFQLSRDRGEHFALPHLPPLPLNPNASNAEYLPSLIHPSTLPSGSKSFKM 142
            ..|||.:...|.|:.:          :|.|                            |:::.::
Human   111 TTLNLMLLHWPVTSTT----------WAKP----------------------------GNRTHRI 137

  Fly   143 RPRMQRLKHSYSYSNI----IVQSNGRKLRTAASTCN-------------IELLNRILEGGANPN 190
            ...:|.       |:|    |:.::|.::.|.....|             ..:|:.:.:.||:.|
Human   138 LTDIQN-------SSITCLRILCAHGAQVNTQGEISNKRSPLHLAIAYGCYPVLSILTQNGADVN 195

  Fly   191 AADEYNRSPLHLAACRGYIPIVQQLLKYGANPN-VVDSLGNTPLHLAVISASS------------ 242
            |.:|.:.:|||:||......:::.|:.||||.| .|.|.|||||.|||.:|||            
Human   196 AINEASMTPLHMAANMLNKEMMETLIAYGANVNCAVSSTGNTPLKLAVCTASSKAGRLLGAGVSC 260

  Fly   243 ---------------------------NNFNVVVGVLLQGGASVHMYDRSNKSPL--------EL 272
                                       .....::.:||:..|:|::..|:.:||:        .:
Human   261 IRLLLTHGAKVNAQDYKGQTAIHEACFGGREAIINLLLEFEANVNILTRNGESPIYMYLQRSCNV 325

  Fly   273 AEAKL--RLLRNRYDHPTPETAKILEDMCMLT--TLILRYMVKQQRELEDLSALEKR-LQNL 329
            .:..|  |||.:.|.........||....||.  .|:...::||.::...|..:.|| ::|:
Human   326 RDTALLARLLYHTYPLRMTNNQGILPAGIMLPEFRLLRDTLIKQSQKPLSLQGICKRNIRNI 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10809NP_001163403.1 Ank_2 167..263 CDD:289560 36/148 (24%)
ANK repeat 167..193 CDD:293786 7/38 (18%)
ANK 170..276 CDD:238125 38/166 (23%)
ANK repeat 195..226 CDD:293786 11/31 (35%)
ANK repeat 228..263 CDD:293786 15/73 (21%)
ANKRD61NP_001258629.1 ANK 1 27..57 3/10 (30%)
ANK <32..115 CDD:295348 14/68 (21%)
ANK 2 75..104 4/28 (14%)
ANK 79..221 CDD:238125 30/186 (16%)
ANK repeat 79..106 CDD:293786 4/26 (15%)
Ank_2 80..198 CDD:289560 23/162 (14%)
ANK repeat 108..163 CDD:293786 14/99 (14%)
ANK 3 132..161 5/35 (14%)
ANK 166..298 CDD:238125 31/131 (24%)
ANK 4 167..196 4/28 (14%)
ANK repeat 169..198 CDD:293786 5/28 (18%)
Ank_2 172..275 CDD:289560 30/102 (29%)
ANK repeat 200..232 CDD:293786 11/31 (35%)
ANK 5 200..229 10/28 (36%)
ANK repeat 234..275 CDD:293786 11/40 (28%)
ANK 6 234..273 11/38 (29%)
Ank_5 263..317 CDD:290568 7/53 (13%)
ANK 272..>351 CDD:238125 13/78 (17%)
ANK repeat 277..308 CDD:293786 4/30 (13%)
ANK 7 277..306 4/28 (14%)
ANK 8 310..343 7/32 (22%)
ANK repeat 319..345 CDD:293786 5/25 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24197
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.