DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RasGAP1 and AT2G21040

DIOPT Version :9

Sequence 1:NP_001261664.1 Gene:RasGAP1 / 39158 FlyBaseID:FBgn0004390 Length:1181 Species:Drosophila melanogaster
Sequence 2:NP_565496.1 Gene:AT2G21040 / 816638 AraportID:AT2G21040 Length:261 Species:Arabidopsis thaliana


Alignment Length:257 Identity:50/257 - (19%)
Similarity:88/257 - (34%) Gaps:84/257 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 GRFVGVTIKVPACVDLAKKQGTCDPFVVCTAHYSNKHQVTRRTKQRKKTVDPEFDEAMYF----- 335
            |.||   :.|.:..|:..|..| :|:|    |...|.: .|:||..||..||:::|...|     
plant    16 GMFV---VIVHSAEDVEGKHHT-NPYV----HIYFKGE-ERKTKHVKKNKDPKWNEEFSFMLEEP 71

  Fly   336 ----DLHIDADAGSTNTTGSNKSAGSLE--------------------SSANKGY-------SIY 369
                .:|:...:.|:......:.| |:|                    |:.:||:       .:.
plant    72 PIHEKMHVKVFSTSSRIVFVLRCA-SVEAAYVPFEGIKPRGAKLFSDGSACSKGFGDTTSFGDMA 135

  Fly   370 PVGGADLVEIVVSVWHDAHGAMSDKVFLGE--------------------------VRLPMLNK- 407
            .:||     :.:.:.|...|.::..|.:.|                          ||...:.: 
plant   136 LLGG-----MAIMLAHHDEGVLTCHVMVRESFEEINMAWRAWKLVRQGAGSSGSWFVRRRFVREL 195

  Fly   408 QEQQAVNPSAW-----YYLQPRSMTHSSRSLNATP-RSCATPPGTRLSVDSTIGSLRLNLNY 463
            ..|:||...|.     :..:|......|..:...| :|...|...|..:.||..|.:.:.:|
plant   196 VRQEAVRQGAGLSGSRFVKEPVRQGAGSSGVGVWPLKSQGRPSDLRFFLKSTFSSFKFHDHY 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RasGAP1NP_001261664.1 C2A_RasA2_RasA3 44..169 CDD:176046
C2B_RasA3 280..462 CDD:175977 46/250 (18%)
RasGAP 449..797 CDD:214617 4/15 (27%)
RasGAP_GAP1_like 473..740 CDD:213330
PH 761..859 CDD:278594
PH_GAP1-like 763..867 CDD:269950
BTK 862..897 CDD:128417
AT2G21040NP_565496.1 C2 18..>82 CDD:175973 20/72 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D145372at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.