DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk8 and CG6800

DIOPT Version :9

Sequence 1:NP_536735.2 Gene:Cdk8 / 39157 FlyBaseID:FBgn0015618 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_650984.1 Gene:CG6800 / 42562 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster


Alignment Length:321 Identity:92/321 - (28%)
Similarity:157/321 - (48%) Gaps:65/321 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KVGRGTYGHVYKA----KWKETSDGKEYALKQIDGTGLSMSACREIALLRELKHQNVITLIRVF- 85
            |:|.|.:|.|:||    :.||.:. |:.|||...| .::::..|||..|:..|.:.::.:|.:: 
  Fly    14 KIGEGVHGCVFKAIDLQRNKEVAI-KKVALKNKFG-NIALNTLREIKTLQLCKSEYILDIIDIYP 76

  Fly    86 ----LSHNDRKVFLLIDYAEHDLWHIIKFHRAAKATKKQVVVP--RGMVKSLLYQILDGIHYLHS 144
                ||       |:::|....|::.:          |..|.|  |..|:...:|:..||.|||.
  Fly    77 DLTGLS-------LVLEYQPDTLYNRL----------KSEVNPLSRQQVRKFAHQMFKGIAYLHE 124

  Fly   145 NWVLHRDLKPANILVMGDGNERGRVKIADMGFARLFNAPLKPLADLDPVVVTFWYRAPELLLGAR 209
            ..::|||:||||:|:    ::...:||||.|.|||: .|........|.|.|.||||||:|.|::
  Fly   125 AGLMHRDIKPANLLI----SDTDMLKIADFGLARLY-FPEDESRLYSPQVSTRWYRAPEILFGSQ 184

  Fly   210 HYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPQDKDWEDIKKMP 274
            .|...:|:||.||:.||:|...|:| ....||        :||..|...:|.|:...|.::..:|
  Fly   185 KYGTGVDMWAAGCVVAEMLRGVPLF-AGTTDI--------EQLAIIIRTLGSPRLNQWPELTSLP 240

  Fly   275 EHHTLTKDFKRST-------YSTCSLAKYMERHKIKPDSKAFHLLQKLLLMDPNKRITSEQ 328
            ::..:.  |..|.       :.:|:       |.::     .:|:..|::.:|..|:.:.:
  Fly   241 DYSKIR--FPNSVGIHWDNLFPSCT-------HAVE-----INLVSNLVVYNPKNRLKASE 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk8NP_536735.2 STKc_CDK8_like 19..335 CDD:270834 92/321 (29%)
S_TKc 22..335 CDD:214567 92/321 (29%)
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 92/321 (29%)
S_TKc 9..288 CDD:214567 92/321 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442414
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.