DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk8 and Cdk2

DIOPT Version :9

Sequence 1:NP_536735.2 Gene:Cdk8 / 39157 FlyBaseID:FBgn0015618 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster


Alignment Length:315 Identity:114/315 - (36%)
Similarity:180/315 - (57%) Gaps:43/315 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KVGRGTYGHVYKAKWKETSDGKEYALKQI----DGTGLSMSACREIALLRELKHQNVITLIRVFL 86
            |:|.||||.||||  :..|.|::.|||:|    :..|:..:|.|||:||:.|||.||:.|..|.:
  Fly    13 KIGEGTYGIVYKA--RSNSTGQDVALKKIRLEGETEGVPSTAIREISLLKNLKHPNVVQLFDVVI 75

  Fly    87 SHNDRKVFLLIDYAEHDLWHIIKFHRAAKATKKQVVVPRGMVKSLLYQILDGIHYLHSNWVLHRD 151
            |.|:  ::::.:|...||..::.       .||.|..|: ::||.::||||.:.:.|:|.:||||
  Fly    76 SGNN--LYMIFEYLNMDLKKLMD-------KKKDVFTPQ-LIKSYMHQILDAVGFCHTNRILHRD 130

  Fly   152 LKPANILVMGDGNERGRVKIADMGFARLFNAPLKPLADLDPVVVTFWYRAPELLLGARHYTKAID 216
            |||.|:||    :..|::|:||.|.||.||.|::....   .|||.||||||:|||.:.|:..:|
  Fly   131 LKPQNLLV----DTAGKIKLADFGLARAFNVPMRAYTH---EVVTLWYRAPEILLGTKFYSTGVD 188

  Fly   217 IWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPQDKDWEDIKKMPEHHTLTK 281
            ||::||||:|::....:|....|         .|||.|||..:..|.:.:|..:.::|:..|   
  Fly   189 IWSLGCIFSEMIMRRSLFPGDSE---------IDQLYRIFRTLSTPDETNWPGVTQLPDFKT--- 241

  Fly   282 DFKRSTYSTCSLAKYMERHKIKPDSKAFHLLQKLLLMDPNKRITSEQAMQDQYFQ 336
              |...:...::.:.:..|      :|..|:..:|..|||.||:::.|:|..||:
  Fly   242 --KFPRWEGTNMPQPITEH------EAHELIMSMLCYDPNLRISAKDALQHAYFR 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk8NP_536735.2 STKc_CDK8_like 19..335 CDD:270834 112/312 (36%)
S_TKc 22..335 CDD:214567 112/312 (36%)
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 114/315 (36%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 112/312 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442412
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.