DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk8 and Eip63E

DIOPT Version :9

Sequence 1:NP_536735.2 Gene:Cdk8 / 39157 FlyBaseID:FBgn0015618 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001261373.1 Gene:Eip63E / 38433 FlyBaseID:FBgn0005640 Length:538 Species:Drosophila melanogaster


Alignment Length:362 Identity:111/362 - (30%)
Similarity:177/362 - (48%) Gaps:57/362 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VGRGTYGHVYKAKWKETSDGKEYALKQI---DGTGLSMSACREIALLRELKHQNVITLIRVFLSH 88
            :|.|:|..|||...|.|.  :..|||:|   :..|...:|.||.:||:||||.|::||..:.  |
  Fly   211 LGEGSYATVYKGFSKLTY--QRVALKEIRLQEEEGAPFTAIREASLLKELKHSNIVTLHDIV--H 271

  Fly    89 NDRKVFLLIDYAEHDLWHIIKFHRAAKATKKQVVVPRGM----VKSLLYQILDGIHYLHSNWVLH 149
            ....:..:.:|...||...::.|            |.|:    |:..|:|:|.|:.|.|...|||
  Fly   272 TRETLTFVFEYVNTDLSQYMEKH------------PGGLDHRNVRLFLFQLLRGLSYCHKRRVLH 324

  Fly   150 RDLKPANILVMGDGNERGRVKIADMGFARLFNAPLKPLADLDPVVVTFWYRAPELLLGARHYTKA 214
            ||:||.|:|:    ::.|.:|:||.|.||..:.|....:.   .|||.|||.|::|||:..|:.:
  Fly   325 RDVKPQNLLI----SDCGELKLADFGLARAKSVPSHTYSH---EVVTLWYRPPDVLLGSTEYSTS 382

  Fly   215 IDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPQDKDWEDIKKMPEHHTL 279
            :|:|.:||||.|::|..|.|    ..|:.:    :||||:||.::|.|.:..|..:...|.:   
  Fly   383 LDMWGVGCIFVEMVTGMPTF----PGIRDT----YDQLDKIFKLLGTPTEDTWPGVTHFPGY--- 436

  Fly   280 TKDFKRSTYSTCSLAKYMER--HKIKPDSKAFHLLQKLLLMDPNKRITSEQAMQDQYFQEEPQPT 342
             |..|...|....|.....|  ..|:.::.|...||    ::|.:|:.::.|:|..||.:.|:..
  Fly   437 -KPHKLGFYRPRKLGHNFPRLYDIIEGETIANGFLQ----LNPEQRLGADDALQHPYFAQLPKKL 496

  Fly   343 QDVFAGCPIPYPKREFLTDDDQ---EDKSDNKRQQQQ 376
            .:      :|.....|..:..|   |....||.:.:|
  Fly   497 YE------LPDETSIFTVEGVQLYTEPNRQNKXKLKQ 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk8NP_536735.2 STKc_CDK8_like 19..335 CDD:270834 101/316 (32%)
S_TKc 22..335 CDD:214567 101/316 (32%)
Eip63ENP_001261373.1 PLN00009 203..492 CDD:177649 103/319 (32%)
STKc_PCTAIRE_like 204..489 CDD:270835 101/316 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442409
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.