DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk8 and CG7028

DIOPT Version :9

Sequence 1:NP_536735.2 Gene:Cdk8 / 39157 FlyBaseID:FBgn0015618 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001286884.1 Gene:CG7028 / 38032 FlyBaseID:FBgn0027587 Length:912 Species:Drosophila melanogaster


Alignment Length:364 Identity:84/364 - (23%)
Similarity:140/364 - (38%) Gaps:93/364 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YKAKWKETSDGKEYALKQIDGTGLSMSACR-----------EIALLR--ELKHQNVITLIRVFLS 87
            |:.:..|..|.: |.:....|.|:..:..|           .|.::|  |:.|:..:..:.:...
  Fly   580 YRVRIGEVLDNR-YLVNGYTGQGVFSNVVRGRDQARGQANVAIKIIRNNEIMHKTGLRELEILKK 643

  Fly    88 HNDRKVFLLIDYAEHDLWHIIKFHR---------------------AAKATKKQVVVPRGMVKSL 131
            .||..        ..|.:|.::.:|                     ..|...|.|.:....|:|.
  Fly   644 LNDAD--------PEDRFHCLRLYRHFFHKQHLCMVFEPLAMNLREVLKKYGKNVGLHIKAVRSY 700

  Fly   132 LYQILDGIHYLHSNWVLHRDLKPANILVMGDGNERGRV-KIADMGFARLFNAPLKPLADLDPVVV 195
            ..|:...:..|....:||.|:||.||||    ||...: |:.|.|.|...:.     .::.|.:|
  Fly   701 TQQLFLALKLLKKTGILHADIKPDNILV----NENNLILKLCDFGSASAISD-----NEITPYLV 756

  Fly   196 TFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQE--------DIKTSNP------ 246
            :.:||:||::||. .|...||.|:.||...||.|.:.:|..:..        |:|...|      
  Fly   757 SRFYRSPEIILGI-PYDYGIDTWSAGCTIYELYTGKILFSGKSNNQMLKFFMDVKGKIPNRIIRK 820

  Fly   247 --YHHDQLDRIFNVMGFPQDK--DWEDIKKMPEHHTLTKDFKRSTYSTCSLAKYMERHKIKPDSK 307
              :.....|:..|.:....||  :.|.|..||    :.|..:       ||.:.:...:..||.:
  Fly   821 GQFREQHFDQSCNFLYHEIDKLTEREKIVVMP----VVKPSR-------SLQQELIADQNLPDDQ 874

  Fly   308 AFH--------LLQKLLLMDPNKRITSEQAMQDQYFQEE 338
              |        ||:.:..:||.|||:..||:...:.||:
  Fly   875 --HRKVTQLKDLLENMFALDPAKRISLNQALVHPFIQEK 911

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk8NP_536735.2 STKc_CDK8_like 19..335 CDD:270834 82/359 (23%)
S_TKc 22..335 CDD:214567 82/359 (23%)
CG7028NP_001286884.1 STKc_PRP4 591..908 CDD:271037 79/348 (23%)
S_TKc 599..908 CDD:214567 78/339 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442408
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.