DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk8 and Cdk4

DIOPT Version :9

Sequence 1:NP_536735.2 Gene:Cdk8 / 39157 FlyBaseID:FBgn0015618 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster


Alignment Length:356 Identity:118/356 - (33%)
Similarity:179/356 - (50%) Gaps:71/356 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QIERTKVE--------DLFNYEGCK-VGRGTYGHVYKAKWKETSDGKEYALKQI----DGTGLSM 61
            |::|.|:.        |.|||:... :|.|.||.||:|  ::...|...|||::    :..|:.|
  Fly     6 QLKRQKMSQAKKFGDGDPFNYQELNIIGEGAYGTVYRA--RDVITGNIVALKKVRISLNENGVPM 68

  Fly    62 SACREIALLREL---KHQNVITLIRV--FLSHNDRKVFLLI-DYAEHDLWHIIKFHRAAKATKKQ 120
            |..|||:||::|   .|.|::.|..|  ||..:.:.:.||: ::.|.||..:|  .|..|:....
  Fly    69 STLREISLLKQLNASNHANIVKLYEVCQFLERDGQLLILLVFEHVEQDLSDLI--DRLPKSGMSP 131

  Fly   121 VVVPRGMVKSLLYQILDGIHYLHSNWVLHRDLKPANILVMGDGNERGRVKIADMGFARLFNAPLK 185
            ..:.|     |..::|.|:.:|||:.::||||||.|:||    :.:|.:||||.|.|:.:.:.:|
  Fly   132 PTIQR-----LSRELLTGVDFLHSHRIIHRDLKPQNLLV----SSQGHLKIADFGLAKTYGSEMK 187

  Fly   186 PLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHD 250
                |..||||.||||||:|| |:.|...:|||:..||..|:.....:|....|         .:
  Fly   188 ----LTSVVVTLWYRAPEVLL-AQPYNSTVDIWSAACIIFEMFNRRALFPGTSE---------KN 238

  Fly   251 QLDRIFNVMGFPQDKDWED-----IKKMPEHH-TLTKDFKRSTYSTC-SLAKYMERHKIKPDSKA 308
            ||||||.:.|.|.::.|..     ::..|:.| ...|||       | .|.||           |
  Fly   239 QLDRIFELTGRPTEQQWPQTISVALEHFPQRHPKRPKDF-------CPHLCKY-----------A 285

  Fly   309 FHLLQKLLLMDPNKRITSEQAMQDQYFQEEP 339
            ..||.|:|..|.:.|.::...::..|||:||
  Fly   286 DDLLNKMLSYDLHLRPSALACLEHDYFQQEP 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk8NP_536735.2 STKc_CDK8_like 19..335 CDD:270834 109/333 (33%)
S_TKc 22..335 CDD:214567 107/330 (32%)
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 107/330 (32%)
S_TKc 26..312 CDD:214567 107/330 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442411
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.