DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk8 and Pk34A

DIOPT Version :9

Sequence 1:NP_536735.2 Gene:Cdk8 / 39157 FlyBaseID:FBgn0015618 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_609603.1 Gene:Pk34A / 34705 FlyBaseID:FBgn0028410 Length:392 Species:Drosophila melanogaster


Alignment Length:273 Identity:82/273 - (30%)
Similarity:134/273 - (49%) Gaps:51/273 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RTKVEDLFNYEGCKVGRGTYGHVYKAKWKETSDGKEYALKQ-IDGTGLSMSACREIALLRELK-H 75
            |.:|:||       :|.|::|.||:|...|:.:  ..|:|| :....||..   |..::.:|| |
  Fly    43 RIEVKDL-------IGSGSFGRVYQAHVNESEE--IVAVKQTLYNPKLSQG---EAEIMGQLKDH 95

  Fly    76 QNVITLIRVFLSHNDRK--------VFLLIDYAEHDLWHIIKFHRAAKATKKQVVVPRGMVKSLL 132
            .|::.||    .|:...        |.|:::|....|...|.:|.......::::    .|:.|.
  Fly    96 NNIVRLI----MHSSVSLGFPSVDYVLLVMEYMPMTLLDYINYHLTVLQPAERLI----NVRILS 152

  Fly   133 YQILDGIHYLHSNWVLHRDLKPANILVMGDGNERGRVKIADMGFARLFNAPLKPLADLDPVVVTF 197
            ||:..|:.|||...:.|||:||.|:|:   .|::..:|::|.|.|:|. .|.:|...   .:.:.
  Fly   153 YQMFRGLGYLHLLGISHRDVKPENLLI---DNQKMVLKLSDFGSAKLL-VPQEPSIS---YICSR 210

  Fly   198 WYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFP 262
            .||||||..|...|:.|:|||:.||:.||||...|:|...:.|.|        ||..|.|::|  
  Fly   211 LYRAPELFAGYELYSCAVDIWSAGCVLAELLKGYPLFSSHKHDRK--------QLRLIVNMLG-- 265

  Fly   263 QDKDWEDIKKMPE 275
                .:.:::.||
  Fly   266 ----TDGLERAPE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk8NP_536735.2 STKc_CDK8_like 19..335 CDD:270834 79/267 (30%)
S_TKc 22..335 CDD:214567 78/264 (30%)
Pk34ANP_609603.1 STKc_GSK3 39..334 CDD:271039 82/273 (30%)
S_TKc 45..328 CDD:214567 81/271 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442370
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.