DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk8 and Cdk1

DIOPT Version :9

Sequence 1:NP_536735.2 Gene:Cdk8 / 39157 FlyBaseID:FBgn0015618 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster


Alignment Length:330 Identity:116/330 - (35%)
Similarity:179/330 - (54%) Gaps:53/330 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VEDLFNYEGCKVGRGTYGHVYKAKWKETSDGKEYALKQI----DGTGLSMSACREIALLRELKHQ 76
            :||....|  |:|.||||.|||.:.:.|  |:..|:|:|    |..|:..:|.|||:||:||||:
  Fly     1 MEDFEKIE--KIGEGTYGVVYKGRNRLT--GQIVAMKKIRLESDDEGVPSTAIREISLLKELKHE 61

  Fly    77 NVITLIRVFLSHNDRKVFLLIDYAEHDLWHIIKFHRAAKATKKQVVVPRGM----VKSLLYQILD 137
            |::.|..|.:..|  :::|:.::...||          |.....:.|.:.|    |:|.||||..
  Fly    62 NIVCLEDVLMEEN--RIYLIFEFLSMDL----------KKYMDSLPVDKHMESELVRSYLYQITS 114

  Fly   138 GIHYLHSNWVLHRDLKPANILVMGDGNERGRVKIADMGFARLFNAPLKPLADLDPVVVTFWYRAP 202
            .|.:.|...||||||||.|:|:    ::.|.:|:||.|..|.|..|::....   .:||.|||||
  Fly   115 AILFCHRRRVLHRDLKPQNLLI----DKSGLIKVADFGLGRSFGIPVRIYTH---EIVTLWYRAP 172

  Fly   203 ELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPQDKDW 267
            |:|||:..|:..:|||:|||||||:.|.:|:|   |.|.:.      |||.|:|.::..|.:..|
  Fly   173 EVLLGSPRYSCPVDIWSIGCIFAEMATRKPLF---QGDSEI------DQLFRMFRILKTPTEDIW 228

  Fly   268 EDIKKMPEHHTLTKDFKRS--TYSTCSLAKYMERHKIKPDSKAFHLLQKLLLMDPNKRITSEQAM 330
            ..:..:|       |:|.:  .:||..|...::    ..|:....|:||:|:.||..||:::..:
  Fly   229 PGVTSLP-------DYKNTFPCWSTNQLTNQLK----NLDANGIDLIQKMLIYDPVHRISAKDIL 282

  Fly   331 QDQYF 335
            :..||
  Fly   283 EHPYF 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk8NP_536735.2 STKc_CDK8_like 19..335 CDD:270834 112/325 (34%)
S_TKc 22..335 CDD:214567 112/322 (35%)
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 113/326 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442413
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.