DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk8 and cdk-1

DIOPT Version :10

Sequence 1:NP_536735.2 Gene:Cdk8 / 39157 FlyBaseID:FBgn0015618 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001022747.1 Gene:cdk-1 / 176374 WormBaseID:WBGene00000405 Length:332 Species:Caenorhabditis elegans


Alignment Length:49 Identity:15/49 - (30%)
Similarity:22/49 - (44%) Gaps:16/49 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TPSRH---------EILSMVKKHSKSLGKTSLDEQDA-----SDVEMDS 42
            |||:.         |...:.|:||...|  ||:|:.:     :||..||
 Worm    84 TPSKKHKFCFSPKLEQSVLEKEHSTQEG--SLEEKKSCTSSLTDVSEDS 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk8NP_536735.2 STKc_CDK8_like 19..335 CDD:270834 11/29 (38%)
cdk-1NP_001022747.1 STKc_CDK1_euk 21..312 CDD:270845 15/49 (31%)

Return to query results.
Submit another query.