DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment I-2 and 2810408A11Rik

DIOPT Version :9

Sequence 1:NP_001097564.1 Gene:I-2 / 39156 FlyBaseID:FBgn0028429 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_001369390.1 Gene:2810408A11Rik / 70419 MGIID:1917669 Length:456 Species:Mus musculus


Alignment Length:280 Identity:70/280 - (25%)
Similarity:118/280 - (42%) Gaps:74/280 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 INDSQPPDVTQIARMQNNPSPQL-----------PCKGILKTSRSFDKSGASF------------ 133
            :|....|.:.::|.:.::.||..           |.:..:.:|.|...||.||            
Mouse    74 LNSGPAPQLQEVASLGSSTSPGTGTGATKASTPGPEEAKVYSSESSTHSGTSFTERPRSILKNSS 138

  Fly   134 -----------RKSAKFDELNVMQTFHPADKDYGHMKIDEPKTPYNYTEGFDENRD-----ELDT 182
                       :||.::||:|::.|:||||||||.||.|||:|||:..:..||:..     ::..
Mouse   139 SILIKKPPGSEKKSQRWDEMNILATYHPADKDYGFMKADEPRTPYHRLQDTDEDPSAESSLKVTP 203

  Fly   183 ELLVEKLRIAANTQPSTESIEDDGSSGDDQPLSEEERQRRREFERRRKAHYREFEAVKLARKLIQ 247
            :.:.|:.....|..|......|:.:|.|....:   :....:|::.||.||.|.:.:|..:.|..
Mouse   204 QSVAERFATMDNFLPKVLQYGDNKNSKDTDNFA---KTYSSDFDKHRKIHYSEGKFLKSPKNLPT 265

  Fly   248 EEDDDDDDEDKGADSRPSGSSQGASS-----------SGRFASS--------------STKRSSS 287
            ||      |..||.:..|.|:|..::           :||.|:.              ||..|::
Mouse   266 EE------ESIGASASISSSNQAVATDLKPRPVEKGWAGRLATGVKNDTVLMTDSHVLSTNDSAT 324

  Fly   288 QADSTTSPS-TSAGQNMDLE 306
            ..:...|.| :|.||..:|:
Mouse   325 YRNQFPSASDSSMGQLANLQ 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
I-2NP_001097564.1 IPP-2 137..247 CDD:282789 36/114 (32%)
2810408A11RikNP_001369390.1 IPP-2 153..268 CDD:398578 38/123 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841941
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1321970at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8857
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.710

Return to query results.
Submit another query.