DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment I-2 and Ppp1r2

DIOPT Version :9

Sequence 1:NP_001097564.1 Gene:I-2 / 39156 FlyBaseID:FBgn0028429 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_080076.1 Gene:Ppp1r2 / 66849 MGIID:1914099 Length:206 Species:Mus musculus


Alignment Length:198 Identity:73/198 - (36%)
Similarity:109/198 - (55%) Gaps:35/198 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 PCKGILKTSRSFDKSGAS------------------FRKSAKFDELNVMQTFHPADKDYGHMKID 161
            |.|||||..    .|.||                  .:||.|:||:|::.|:||||||||.||||
Mouse    10 PIKGILKNK----TSAASPPVVPSAEQPRPIVEEELSKKSQKWDEMNILATYHPADKDYGLMKID 70

  Fly   162 EPKTPYNYTEGFDEN-------RDELDTELLVEKLRIAANTQPSTESIEDDGSSGDDQPLSEEER 219
            ||.|||:...|.||:       .:.:..::|.:||..|..::|...:.|.:.|..:|..||.|||
Mouse    71 EPNTPYHNMIGDDEDAYSDSEGNEVMTPDILAKKLAAAEGSEPKYRTREQESSGEEDNDLSPEER 135

  Fly   220 QRRREFERRRKAHYREFEAVKLARKLIQEEDDDDDDEDKGADSRPSG------SSQGASSSGRFA 278
            :::|:||.:||.||.|...:||||:||.::..|||::::.|::....      ||||:::|....
Mouse   136 EKKRQFEMKRKLHYNEGLNIKLARQLISKDLHDDDEDEEMAETADGDSMNVEESSQGSTTSDHLQ 200

  Fly   279 SSS 281
            ..|
Mouse   201 HKS 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
I-2NP_001097564.1 IPP-2 137..247 CDD:282789 51/116 (44%)
Ppp1r2NP_080076.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36 9/29 (31%)
Required for binding PPP1CC 12..17 4/4 (100%)
Required for binding the 'RVXF' binding groove of PPP1CC 44..56 6/11 (55%)
IPP-2 46..165 CDD:398578 52/118 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..143 20/67 (30%)
Required for binding PPP1CC catalytic center, displacing metal ions and inhibition of PPP1CC catalytic activity 148..151 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 164..206 10/40 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 113 1.000 Domainoid score I6157
eggNOG 1 0.900 - - E1_KOG4041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4702
Isobase 1 0.950 - 0 Normalized mean entropy S2946
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1321970at2759
OrthoFinder 1 1.000 - - FOG0003529
OrthoInspector 1 1.000 - - mtm8857
orthoMCL 1 0.900 - - OOG6_106897
Panther 1 1.100 - - LDO PTHR12398
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4306
SonicParanoid 1 1.000 - - X2894
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.810

Return to query results.
Submit another query.