DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment I-2 and PPP1R2

DIOPT Version :9

Sequence 1:NP_001097564.1 Gene:I-2 / 39156 FlyBaseID:FBgn0028429 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_001278433.1 Gene:PPP1R2 / 5504 HGNCID:9288 Length:206 Species:Homo sapiens


Alignment Length:200 Identity:78/200 - (39%)
Similarity:107/200 - (53%) Gaps:31/200 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 PCKGILKTSRSFDKSGAS-------------FRKSAKFDELNVMQTFHPADKDYGHMKIDEPKTP 166
            |.|||||...|...|..:             .:||.|:||:|::.|:||||||||.||||||.||
Human    10 PIKGILKNKTSTTSSMVASAEQPRGNVDEELSKKSQKWDEMNILATYHPADKDYGLMKIDEPSTP 74

  Fly   167 YNYTEGFDENRDELDTE--------LLVEKLRIAANTQPSTESIEDDGSSGDDQPLSEEER-QRR 222
            |:...|.||:... |||        :|..||..|...:|.....|.:.|..:|..||.||| :::
Human    75 YHSMMGDDEDACS-DTEATEAMAPDILARKLAAAEGLEPKYRIQEQESSGEEDSDLSPEERGKKK 138

  Fly   223 REFERRRKAHYREFEAVKLARKLIQEE-DDDDDDED-----KGADSRPSGSSQGASSSGRFASSS 281
            |:||.:||.||.|...:||||:||.:: .|||:||:     .|.......|:||::.|.:  ..:
Human   139 RQFEMKRKLHYNEGLNIKLARQLISKDLHDDDEDEEMLETADGESMNTEESNQGSTPSDQ--QQN 201

  Fly   282 TKRSS 286
            ..|||
Human   202 KLRSS 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
I-2NP_001097564.1 IPP-2 137..247 CDD:282789 54/118 (46%)
PPP1R2NP_001278433.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 8/33 (24%)
Required for binding PPP1CC. /evidence=ECO:0000250 12..17 4/4 (100%)
Required for binding PPP1CC. /evidence=ECO:0000250 43..55 6/11 (55%)
IPP-2 45..164 CDD:282789 55/119 (46%)
Required for binding PPP1CC catalytic center, displacing metal ions and inhibition of PPP1CC catalytic activity. /evidence=ECO:0000250 148..151 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 164..206 11/43 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 111 1.000 Domainoid score I6236
eggNOG 1 0.900 - - E1_KOG4041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4735
Isobase 1 0.950 - 0 Normalized mean entropy S2946
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1321970at2759
OrthoFinder 1 1.000 - - FOG0003529
OrthoInspector 1 1.000 - - mtm8624
orthoMCL 1 0.900 - - OOG6_106897
Panther 1 1.100 - - LDO PTHR12398
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4306
SonicParanoid 1 1.000 - - X2894
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.850

Return to query results.
Submit another query.