DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment I-2 and Ppp1r2

DIOPT Version :9

Sequence 1:NP_001097564.1 Gene:I-2 / 39156 FlyBaseID:FBgn0028429 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_620178.1 Gene:Ppp1r2 / 192361 RGDID:621099 Length:205 Species:Rattus norvegicus


Alignment Length:186 Identity:74/186 - (39%)
Similarity:105/186 - (56%) Gaps:25/186 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 PCKGILKTSRSFDKSGAS-------------FRKSAKFDELNVMQTFHPADKDYGHMKIDEPKTP 166
            |.|||||...|...|..:             .:||.|:||:|::.|:||||||||.||||||.||
  Rat    10 PIKGILKNKTSTTSSVVASAEQPRRTVEEELSKKSQKWDEMNILATYHPADKDYGLMKIDEPDTP 74

  Fly   167 YNYTEGFDEN-------RDELDTELLVEKLRIAANTQPSTESIEDDGSSGDDQPLSEEERQRRRE 224
            |:...|.||:       .:.:..|:|.:||..|..::|...:.|.:.|..:|..||.|||:::|:
  Rat    75 YHNMIGDDEDVCSDSEGNEVMTPEILAKKLAAAEGSEPKFRTREQESSGEEDNDLSPEEREKKRQ 139

  Fly   225 FERRRKAHYREFEAVKLARKLIQEE-DDDDDDEDKG----ADSRPSGSSQGASSSG 275
            ||.:||.||.|...:||||:||.:: .|||:||:..    |||.....|...|::|
  Rat   140 FEMKRKLHYNEGLNIKLARQLISKDLHDDDEDEEMSETADADSMNIEESNQGSTAG 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
I-2NP_001097564.1 IPP-2 137..247 CDD:282789 52/116 (45%)
Ppp1r2NP_620178.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 8/33 (24%)
Required for binding PPP1CC. /evidence=ECO:0000250 12..17 4/4 (100%)
Required for binding PPP1CC. /evidence=ECO:0000250 43..55 6/11 (55%)
IPP-2 45..163 CDD:282789 53/117 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..142 13/37 (35%)
Required for binding PPP1CC catalytic center, displacing metal ions and inhibition of PPP1CC catalytic activity. /evidence=ECO:0000250 147..150 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..205 11/33 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 114 1.000 Domainoid score I5950
eggNOG 1 0.900 - - E1_KOG4041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4627
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1321970at2759
OrthoFinder 1 1.000 - - FOG0003529
OrthoInspector 1 1.000 - - mtm9103
orthoMCL 1 0.900 - - OOG6_106897
Panther 1 1.100 - - LDO PTHR12398
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2894
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.