DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment I-2 and szy-2

DIOPT Version :9

Sequence 1:NP_001097564.1 Gene:I-2 / 39156 FlyBaseID:FBgn0028429 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_498147.1 Gene:szy-2 / 175738 WormBaseID:WBGene00021312 Length:193 Species:Caenorhabditis elegans


Alignment Length:168 Identity:61/168 - (36%)
Similarity:89/168 - (52%) Gaps:20/168 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 PCKGILKTSRSFDKSGASFRKSAKFDELNVMQTFHPADKDYGHMKIDEPKTPYNYTEGFDE---- 175
            |.|.|||..:.....|...|  |.|||:|::.|:||.|||||.||||||||||::::|..|    
 Worm    32 PKKSILKMKQDSSLEGKDGR--AHFDEMNILATYHPTDKDYGSMKIDEPKTPYHHSDGESECDEG 94

  Fly   176 ---------NRDELDTELLVEKLRIAANTQPSTESIEDDGSSGDDQPLSEEERQRRREFERRRKA 231
                     .|..|...:..||:........|.:|:.....|.|:..|:||:|..||:||::|:|
 Worm    95 VLGVPTTRPRRVSLGNAIDPEKVAEGLAHPESGKSLSSAEDSEDEADLTEEQRAHRRDFEKKRRA 159

  Fly   232 HYREFEAVKLARKLIQEEDDDDDDEDKGADSRPSGSSQ 269
            ||.|..|:|...:|     :||::|...|.:...|:.:
 Worm   160 HYNEGAALKHHPEL-----EDDEEEATAAAAGAGGNME 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
I-2NP_001097564.1 IPP-2 137..247 CDD:282789 49/122 (40%)
szy-2NP_498147.1 IPP-2 52..169 CDD:282789 47/116 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167265
Domainoid 1 1.000 93 1.000 Domainoid score I4766
eggNOG 1 0.900 - - E1_KOG4041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I3577
Isobase 1 0.950 - 0 Normalized mean entropy S2946
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1321970at2759
OrthoFinder 1 1.000 - - FOG0003529
OrthoInspector 1 1.000 - - otm14668
orthoMCL 1 0.900 - - OOG6_106897
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4306
SonicParanoid 1 1.000 - - X2894
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.680

Return to query results.
Submit another query.