DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment I-2 and PPP1R2B

DIOPT Version :9

Sequence 1:NP_001097564.1 Gene:I-2 / 39156 FlyBaseID:FBgn0028429 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_996740.2 Gene:PPP1R2B / 153743 HGNCID:16318 Length:205 Species:Homo sapiens


Alignment Length:200 Identity:79/200 - (39%)
Similarity:109/200 - (54%) Gaps:32/200 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 PCKGILKTS---------------RSFDKSGASFRKSAKFDELNVMQTFHPADKDYGHMKIDEPK 164
            |.|||||..               ||.|:..:  :||.|:||:|::.|:|||||.||.||||||.
Human    10 PIKGILKNKTSTTSSMVASAEQPRRSVDEELS--KKSQKWDEINILATYHPADKGYGLMKIDEPS 72

  Fly   165 TPYNYTEGFDEN--RDELDTE-----LLVEKLRIAANTQPSTESIEDDGSSGDDQPLSEEERQRR 222
            .||:...|.||:  ||...||     :|.:||..|...:|.....|.:.|..:|..||.|||:::
Human    73 PPYHSMMGDDEDACRDTETTEAMAPDILAKKLAAAEGLEPKYRIQEQESSGEEDSDLSPEEREKK 137

  Fly   223 REFERRRKAHYREFEAVKLARKLIQEE-DDDDDDED-----KGADSRPSGSSQGASSSGRFASSS 281
            |:||.|||.||.|...:||||:||.:: .|||:||:     .|.......|:||::.|.:  ..:
Human   138 RQFEMRRKLHYNEGLNIKLARQLISKDLHDDDEDEEMLETADGESMNTEESNQGSTPSDQ--QQN 200

  Fly   282 TKRSS 286
            ..|||
Human   201 KLRSS 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
I-2NP_001097564.1 IPP-2 137..247 CDD:282789 54/116 (47%)
PPP1R2BNP_996740.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 9/35 (26%)
Required for binding PPP1CC. /evidence=ECO:0000250 12..17 4/4 (100%)
Required for binding PPP1CC. /evidence=ECO:0000250 43..55 6/11 (55%)
IPP-2 45..164 CDD:309902 55/118 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..142 11/30 (37%)
Required for binding PPP1CC catalytic center, displacing metal ions and inhibition of PPP1CC catalytic activity. /evidence=ECO:0000250 147..150 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..205 11/43 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 111 1.000 Domainoid score I6236
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4735
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1321970at2759
OrthoFinder 1 1.000 - - FOG0003529
OrthoInspector 1 1.000 - - mtm8624
orthoMCL 1 0.900 - - OOG6_106897
Panther 1 1.100 - - O PTHR12398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2894
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.