DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment I-2 and ppp1r2

DIOPT Version :9

Sequence 1:NP_001097564.1 Gene:I-2 / 39156 FlyBaseID:FBgn0028429 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_001163967.1 Gene:ppp1r2 / 100038193 XenbaseID:XB-GENE-479701 Length:187 Species:Xenopus tropicalis


Alignment Length:183 Identity:71/183 - (38%)
Similarity:105/183 - (57%) Gaps:28/183 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 QLPCKGILKTSRS--------------FDKSGASFRKSAKFDELNVMQTFHPADKDYGHMKIDEP 163
            |.|.|||||...|              .|:.....:||.|:||:|::.|:||:|||||.||||||
 Frog     6 QRPIKGILKNKGSEKHGVCVISKPETASDREEDQSKKSQKWDEMNILATYHPSDKDYGLMKIDEP 70

  Fly   164 KTPYNYTEGFD--------ENRDELDTELLVEKLRIAANTQPSTESIEDDGSSGDDQPLSEEERQ 220
            .|||:...|.|        |:.::|..::|.|||..|..|.|...: :.:.|..:::.|:||||:
 Frog    71 STPYHRMIGDDDEGAMSDSESNEDLTADVLAEKLAAAEGTDPKFLA-QSESSDEEEEELTEEERE 134

  Fly   221 RRREFERRRKAHYREFEAVKLARKLIQEE-----DDDDDDEDKGADSRPSGSS 268
            :|:|||.:||.||.|...:||||:||.:|     |:|:|::::..|.....||
 Frog   135 KRKEFEMKRKHHYNEGMNIKLARQLIAKELAGEVDEDEDEDEEMQDITDRSSS 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
I-2NP_001097564.1 IPP-2 137..247 CDD:282789 52/117 (44%)
ppp1r2NP_001163967.1 IPP-2 44..158 CDD:368219 50/114 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 108 1.000 Domainoid score I6358
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4623
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1321970at2759
OrthoFinder 1 1.000 - - FOG0003529
OrthoInspector 1 1.000 - - otm48615
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4306
SonicParanoid 1 1.000 - - X2894
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.