DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43897 and SMPD1

DIOPT Version :9

Sequence 1:NP_001261659.1 Gene:CG43897 / 39153 FlyBaseID:FBgn0264489 Length:1385 Species:Drosophila melanogaster
Sequence 2:NP_000534.3 Gene:SMPD1 / 6609 HGNCID:11120 Length:631 Species:Homo sapiens


Alignment Length:257 Identity:56/257 - (21%)
Similarity:81/257 - (31%) Gaps:97/257 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   926 VTTPATESPPPSTPPPPPP--PPPRQLALQKPETEVTWERS---------------RSPSPLPSR 973
            ::.|....|||..|.||.|  |..|.|.|    |::.|:..               |..|.||..
Human   178 ISLPTVPKPPPKPPSPPAPGAPVSRILFL----TDLHWDHDYLEGTDPDCADPLCCRRGSGLPPA 238

  Fly   974 KYPA-------PLIEAPQRS--SSPYGLNPVQTKAPPSPVNLPAKFTHVPQLEGHNIGLLVKTAT 1029
            ..|.       ...:.|.|:  |...||.|.      .|.::......:|   .|::.      .
Human   239 SRPGAGYWGEYSKCDLPLRTLESLLSGLGPA------GPFDMVYWTGDIP---AHDVW------H 288

  Fly  1030 EPLQQSMSASSTMLAATPPRSAAQPTPFEFPSLEQAEEQHKFKSLASFDEVQRDFGVNRSFDNVS 1094
            :..|..:.|.:|:.|..  |....|.|. :|    |...|:...:.||                 
Human   289 QTRQDQLRALTTVTALV--RKFLGPVPV-YP----AVGNHESTPVNSF----------------- 329

  Fly  1095 PRPYLGIEG-------YKRVA-----WPPASEERIIREFTPQPQTQSPAPGAGGYYPQAHAP 1144
            |.|:  |||       |:.:|     |.||...|.:|              .||:|..:..|
Human   330 PPPF--IEGNHSSRWLYEAMAKAWEPWLPAEALRTLR--------------IGGFYALSPYP 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43897NP_001261659.1 DUF4749 7..108 CDD:292558
SMPD1NP_000534.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
SapB 89..162 CDD:214797
MPP_ASMase 203..498 CDD:277321 46/232 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3770
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.