DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43897 and smpdl3a

DIOPT Version :9

Sequence 1:NP_001261659.1 Gene:CG43897 / 39153 FlyBaseID:FBgn0264489 Length:1385 Species:Drosophila melanogaster
Sequence 2:XP_005170233.1 Gene:smpdl3a / 541525 ZFINID:ZDB-GENE-050327-61 Length:444 Species:Danio rerio


Alignment Length:318 Identity:66/318 - (20%)
Similarity:105/318 - (33%) Gaps:84/318 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1078 DEVQRDFGVN----------RSFDNVSPRPYLGIEGYKRVAWP----PASE----ERIIREFTPQ 1124
            :|:..|..:|          :.|..:...|.||...|    ||    |.||    :.:.:.::| 
Zfish   114 EELSTDVVINVIANMTRTIQQFFPQIPVYPALGNHDY----WPQDQFPTSENAIYDAVAKLWSP- 173

  Fly  1125 PQTQSPAPGA----GGYYPQAHAPTAAAAAPPQQQYGAP---SYDGQQPGAQWQQQQQQQQVPQQ 1182
              ..:||..|    ||:|.....|.....:.....|.:|   :.:...|..|:|..|:..::.:|
Zfish   174 --WLNPAAVATLQKGGFYSLVIKPGLRLLSLNTNLYYSPNEVTVNMSDPAGQFQWLQETLELSRQ 236

  Fly  1183 QYQP-QSQAQAP--YQP---------PQWNQP----------------------------QQQQQ 1207
            ..:. ...|..|  |.|         ..:|:.                            ..||.
Zfish   237 SMEKVYVIAHVPIGYLPFAKNTTAMRENYNEQLVKIFRNYSEVVEGQFYGHTHRDSIMVLLDQQG 301

  Fly  1208 QP--SYQASPYQQQQQQQPSYYPQQNGGSTYAQPPYNSYSQPQLPYSQDQTDLQQQQQQQQQQYP 1270
            :|  |...:|.....:.|...:....|...|...| :||:  .|...|...:|.:...:|:..:.
Zfish   302 KPVNSIFVTPAVTPIKSQIEPFSNNPGVRAYLYQP-DSYT--LLDIWQFYLNLTEANLEQRSGWK 363

  Fly  1271 GAYA-----GQDSYRGASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLK 1323
            ..|.     |.|..:..|...:.||.|.|.| |....|.|. ..|||...::..||.|
Zfish   364 LEYIMTEAFGIDDIQPGSLQELALRFEKPQS-KAFDKYFSN-FMVSYNISARCEGDCK 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43897NP_001261659.1 DUF4749 7..108 CDD:292558
smpdl3aXP_005170233.1 MPP_ASMase 36..330 CDD:277321 40/222 (18%)
Metallophos 71..291 CDD:278574 33/183 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3770
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.