DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43897 and Pdlim3

DIOPT Version :10

Sequence 1:NP_001261659.1 Gene:CG43897 / 39153 FlyBaseID:FBgn0264489 Length:1385 Species:Drosophila melanogaster
Sequence 2:NP_001361581.1 Gene:Pdlim3 / 53318 MGIID:1859274 Length:364 Species:Mus musculus


Alignment Length:106 Identity:30/106 - (28%)
Similarity:42/106 - (39%) Gaps:33/106 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLVHKQFNSPMGLYSQENVKATLNRELKAFGGEGIEVDDQITKPLNLANSAVLRAVEEEEQQAKC 71
            |:||.|||:||.|||.:|:..||..::....||        |..::...::|.            
Mouse   184 KIVHAQFNTPMQLYSDDNIMETLQGQVATALGE--------TSSMSEPTASVP------------ 228

  Fly    72 GDFPHKDFYPTERQSR-----PRQRGEVDALHHTLHQQLLN 107
               |..|.|.....:|     |||.|....|     |.|:|
Mouse   229 ---PQSDVYRMLHDNRDDPAAPRQSGSFRVL-----QDLVN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43897NP_001261659.1 DUF4749 7..119 CDD:464948 30/106 (28%)
ZM 7..32 CDD:128974 14/24 (58%)
Pdlim3NP_001361581.1 PDZ_PDLIM-like 4..82 CDD:467235
DUF4749 184..268 CDD:464948 30/106 (28%)
LIM_ALP 294..346 CDD:188834
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.