DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43897 and CG15534

DIOPT Version :9

Sequence 1:NP_001261659.1 Gene:CG43897 / 39153 FlyBaseID:FBgn0264489 Length:1385 Species:Drosophila melanogaster
Sequence 2:NP_651792.1 Gene:CG15534 / 43613 FlyBaseID:FBgn0039769 Length:666 Species:Drosophila melanogaster


Alignment Length:419 Identity:78/419 - (18%)
Similarity:130/419 - (31%) Gaps:139/419 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 VLRAVEEEEQQAK------CGDFPHKDFYPTERQSRPRQRGEVDAL---------------HHTL 101
            :|.|.|..::..|      .||.|..:.:.|.||.......|:|.|               :|..
  Fly   271 ILSAFEHIKENHKIEWIYHTGDVPPHNVWSTTRQGNLDMLSEIDELLAKYFPDTPIYPCLGNHEP 335

  Fly   102 H-------QQLLNQIKTDYLSHQQDITIDRDTVLKINRLATKRHLLKRDHSWPPAEQDQPTINPE 159
            |       .::.:.::.|:|                     ..|:......|.|||.::..:   
  Fly   336 HPANVFGNDEIPSSLRVDWL---------------------YEHVWSLWSKWLPAEAEETVL--- 376

  Fly   160 QSHQISCSPS--HSIEALREK---------FQSPTLVIEP---------TANEVREQ-------R 197
            :....:.|||  |.|.||...         |.:.||:.|.         :|.|..|.       .
  Fly   377 RGGYYTASPSKGHRIVALNSMDCYLYNWWLFYNATLIQEQLQWFHDTLLSAEEAGESVHILTHIP 441

  Fly   198 RRDGG-----SKERSKTLQK-----------HTKEPDL----AEVFHQTPIS-KGFSAPETKAAD 241
            ..||.     |:|.::.|.:           ||.:.::    :|..:.|.:: .|.|.......:
  Fly   442 AGDGDCWCNWSQEYNRVLTRFNGIITGVFSGHTHKDEMNLHYSEDGYATVVNWNGGSLTSYSNKN 506

  Fly   242 VDLGLVAPRCEYYEQLAHKRSATPTLPTQITP-YRPRYK-----------------------RQA 282
            .:..|.....|.::.|.|...........:|| .:|:::                       ..|
  Fly   507 PNYRLYELHPENWQVLDHHTYTFNLTEANLTPDEQPKWELEYQFTKEYTEDTSPAGIDRLLLEMA 571

  Fly   283 HSLDRSRS---RKRTVGAPELPPP-----------KPRTSKPKVQRRCIKLATEVKISYGHDGDS 333
            ...|..|.   .|.|...|:|...           :..||..:.:.||.:|...:..|..::.|:
  Fly   572 EKPDLLRKFWRNKFTNSDPKLAEGCDNACLSKTICRIATSNYQERTRCKELQAILAESLENEPDT 636

  Fly   334 EDDPNSGQDVDLETLPLPPTPVSPAAANL 362
             ||.|.|....|..|.|.......||:.|
  Fly   637 -DDNNGGGAAGLSALSLASLLALLAASKL 664

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43897NP_001261659.1 DUF4749 7..108 CDD:292558 15/77 (19%)
CG15534NP_651792.1 MPP_ASMase 215..510 CDD:277321 47/262 (18%)
Metallophos 271..477 CDD:278574 43/229 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3770
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.