DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43897 and pdlim4

DIOPT Version :9

Sequence 1:NP_001261659.1 Gene:CG43897 / 39153 FlyBaseID:FBgn0264489 Length:1385 Species:Drosophila melanogaster
Sequence 2:NP_989251.1 Gene:pdlim4 / 394862 XenbaseID:XB-GENE-1001790 Length:332 Species:Xenopus tropicalis


Alignment Length:166 Identity:40/166 - (24%)
Similarity:69/166 - (41%) Gaps:19/166 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   973 RKYPAPLIEAPQRSSSPYGLNPVQTKAPPSPVNLPAKFTHVPQLEGHNIGLLVKTATEPLQQSMS 1037
            |||.   :||..:...|..:...:..||.||...|:....:| |:.:|....:.|....::.::|
 Frog    99 RKYS---LEAELQDIFPTEITQTRRSAPVSPRGSPSDSRQIP-LQQYNNPSKLYTNNNNIEANLS 159

  Fly  1038 ASSTMLAATPPRSAAQPTPFEFPSLEQAE-----EQHKFKSLASFDEVQRDFGVNRSFDNVSPRP 1097
            :....:..:.|:|.   .||.  |:.:::     |...:|.|..:.|.......:.||..:....
 Frog   160 SHMARINLSSPQSV---DPFR--SVPKSKNGIDTESDVYKMLQDYVEPVSQPKQSGSFKYLQDML 219

  Fly  1098 YLGIEGYKRVAWPPASEERIIREFTPQPQTQSPAPG 1133
            ..|..|.|... ||:|  |.|:  :|..:..||.||
 Frog   220 EAGENGEKPER-PPSS--RNIK--SPVSKLSSPLPG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43897NP_001261659.1 DUF4749 7..108 CDD:292558
pdlim4NP_989251.1 PDZ_signaling 5..80 CDD:238492
DUF4749 140..231 CDD:374237 17/96 (18%)
LIM_RIL 257..309 CDD:188835
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12238
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.