DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43897 and Smpdl3a

DIOPT Version :9

Sequence 1:NP_001261659.1 Gene:CG43897 / 39153 FlyBaseID:FBgn0264489 Length:1385 Species:Drosophila melanogaster
Sequence 2:NP_001005539.1 Gene:Smpdl3a / 294422 RGDID:1359277 Length:445 Species:Rattus norvegicus


Alignment Length:283 Identity:57/283 - (20%)
Similarity:99/283 - (34%) Gaps:78/283 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 DPNSGQDVDLETLPLPPTPVSPAAANLNQAKTAGRMVID-NVAVKQQQQMALALATNGSISPVNP 399
            ||..|       :||.|...:||   :.|......:.:| ...:........|.:...::|  ||
  Rat    18 DPGLG-------VPLAPAYGAPA---VGQFWHVTDLHLDPTYHITDDHTKVCASSKGANVS--NP 70

  Fly   400 SPSPLANTRIVPIRVEASADQLKLSAQQIYDDACSYLQDH-QEMEDIQPRTESPTYVS----ATG 459
            .|               ..|.|..|..|:...|..::::. ||...:....:||.:|.    :||
  Rat    71 GP---------------FGDVLCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVRELSTG 120

  Fly   460 G-IKLLQRQSSST----PSTPVPPPLPS---------PIMRS----------KSGQDSQAKENQT 500
            . |:::...:.:.    |:..|.|.|.:         ||..|          |...|.:|  ..|
  Rat   121 SVIEVITNMTVTVQNLFPNLQVFPALGNHDYWPQDQLPIATSKVYSAVSDLWKPWLDEEA--IST 183

  Fly   501 KRQGRIYSLETATEKQHEAHVEIAQLEAKYAHIQQSIAEHLLQID--------AYMENAKQALQR 557
            .|:|..||.:.|:...    :.|..|.....:     ..:::.::        .::||...:..|
  Rat   184 LRKGGFYSQKVASNPD----LRIISLNTNLYY-----GPNIMTLNKTDPANQFEWLENTLNSSLR 239

  Fly   558 SAQTTPVSTPVPIP--PTATATP 578
            :.:...|...||:.  |.||.||
  Rat   240 NKEKVYVIAHVPVGYLPYATKTP 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43897NP_001261659.1 DUF4749 7..108 CDD:292558
Smpdl3aNP_001005539.1 MPP_ASMase 37..333 CDD:277321 48/254 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3770
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.