DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG43897 and Smpdl3b

DIOPT Version :9

Sequence 1:	NP_001261659.1	Gene:	CG43897 / 39153	FlyBaseID:	FBgn0264489	Length:	1385	Species:	Drosophila melanogaster
Sequence 2:	NP_598649.1	Gene:	Smpdl3b / 100340	MGIID:	1916022	Length:	456	Species:	Mus musculus

Alignment Length:	162	Identity:	33/162 - (20%)
Similarity:	55/162 - (33%)	Gaps:	69/162 - (42%)

- Green bases have known domain annotations that are detailed below.

  Fly    14 NSPMGLYSQENVKATLNRELKAFGGEGIEVDDQITKPLNLANSAVLRAVEEEEQQAKCGDFP--H 76
            |:| |:...|..:||||            :.|.:|..|||             :||...:.|  .
Mouse   318 NNP-GIRIFEYDRATLN------------LKDLVTYFLNL-------------RQANVQETPRWE 356

  Fly    77 KDFYPTERQSRPRQRGEVDALHHTLHQQLLNQIKTDYLSHQQDITIDRDTVLKINRLATKRHLLK 141
            :::..||....|      ||...::|..|                         .|:|::.|:|:
Mouse   357 QEYRLTEAYQVP------DASVSSMHTAL-------------------------TRIASEPHILQ 390

  Fly   142 RDHSWPPAEQDQPTINPEQSHQISCSPSHSIE 173
            |.:.:          |....:.::|..|..||
Mouse   391 RYYVY----------NSVSYNHLTCEDSCRIE 412

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG43897	NP_001261659.1	DUF4749	7..108	CDD:292558	23/95 (24%)
Smpdl3b	NP_598649.1	Metallophos	22..281	CDD:278574
Smpdl3b	NP_598649.1	MPP_ASMase	23..323	CDD:277321	3/5 (60%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3770
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900