DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp4 and insl3

DIOPT Version :9

Sequence 1:NP_648361.1 Gene:Ilp4 / 39152 FlyBaseID:FBgn0044049 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001108525.2 Gene:insl3 / 563417 ZFINID:ZDB-GENE-050310-5 Length:153 Species:Danio rerio


Alignment Length:156 Identity:42/156 - (26%)
Similarity:59/156 - (37%) Gaps:41/156 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LALLLLLATVSQLLQPVQGRRKMCGEALIQALDVICVNGFTRRVRRSSASKDARVRDLIRKLQ-- 70
            |:.|:||.|  .:.:....|.|:||...::.:...| ..|  ||:||....|.......|.||  
Zfish     9 LSFLILLKT--SMAESEDVRVKLCGREFVRTVVASC-GSF--RVKRSMPDSDLHFAYPYRNLQNW 68

  Fly    71 -----------QPDEDIEQ--ETETGRLKQKHTDADTEKGVPPA-------------VGSGRKLR 109
                       .|..:.||  |.:|....:.|.| ..:...|||             |.|     
Zfish    69 LDRDLVVHQRGSPAVEDEQWRERDTPESVRGHPD-PRQHTSPPAEPLDHSTTMQDLSVSS----- 127

  Fly   110 RHRRRI--AHECCKEGCTYDDILDYC 133
            |.||..  |..||..|||.::::.||
Zfish   128 RSRRDAGPAGVCCTSGCTMNELIQYC 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp4NP_648361.1 IlGF_insulin_bombyxin_like <115..133 CDD:239832 6/19 (32%)
insl3NP_001108525.2 IlGF_relaxin_like 26..153 CDD:239831 35/135 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1570392at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10423
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.