powered by:
Protein Alignment Ilp4 and INSL3
DIOPT Version :9
Sequence 1: | NP_648361.1 |
Gene: | Ilp4 / 39152 |
FlyBaseID: | FBgn0044049 |
Length: | 134 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001252516.1 |
Gene: | INSL3 / 3640 |
HGNCID: | 6086 |
Length: | 157 |
Species: | Homo sapiens |
Alignment Length: | 63 |
Identity: | 19/63 - (30%) |
Similarity: | 30/63 - (47%) |
Gaps: | 9/63 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 SLIRLGLALLLLLATVSQLLQPV-QGRRKMCGEALIQALDVICVNG--FTRRVRRSSASKDAR 61
:|:.||.||:..|... |. :.|.|:||...::||..:| .| ::...||.:...|.|
Human 9 ALVLLGPALVFALGPA-----PTPEMREKLCGHHFVRALVRVC-GGPRWSTEARRPATGGDQR 65
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_127938 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR10423 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.000 |
|
Return to query results.
Submit another query.