DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp4 and INSL3

DIOPT Version :9

Sequence 1:NP_648361.1 Gene:Ilp4 / 39152 FlyBaseID:FBgn0044049 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001252516.1 Gene:INSL3 / 3640 HGNCID:6086 Length:157 Species:Homo sapiens


Alignment Length:63 Identity:19/63 - (30%)
Similarity:30/63 - (47%) Gaps:9/63 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLIRLGLALLLLLATVSQLLQPV-QGRRKMCGEALIQALDVICVNG--FTRRVRRSSASKDAR 61
            :|:.||.||:..|...     |. :.|.|:||...::||..:| .|  ::...||.:...|.|
Human     9 ALVLLGPALVFALGPA-----PTPEMREKLCGHHFVRALVRVC-GGPRWSTEARRPATGGDQR 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp4NP_648361.1 IlGF_insulin_bombyxin_like <115..133 CDD:239832
INSL3NP_001252516.1 IlGF_relaxin_like 32..>52 CDD:239831 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_127938
Panther 1 1.100 - - LDO PTHR10423
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.