DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp4 and Insl3

DIOPT Version :9

Sequence 1:NP_648361.1 Gene:Ilp4 / 39152 FlyBaseID:FBgn0044049 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_038592.3 Gene:Insl3 / 16336 MGIID:108427 Length:122 Species:Mus musculus


Alignment Length:133 Identity:39/133 - (29%)
Similarity:58/133 - (43%) Gaps:27/133 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLLATVSQLL--QPVQGRRKMCGEALIQALDVICVNGFTRRVRRSSASKDARVRDLIRKLQQP 72
            ||:|||..|.|.  ||.:.|.|:||..|::.|..:|  |..|....::...:.|.|:|::.|:  
Mouse     6 LLMLLALGSALRSPQPPEARAKLCGHHLVRTLVRVC--GGPRWSPEATQPVETRDRELLQWLE-- 66

  Fly    73 DEDIEQETETGRLKQKH----TDADTEKGVPPAV---GSGRKLRRHRRRIAHECCKEGCTYDDIL 130
                          |:|    ..||.:..:.|.:   .|.|:.|.......|.||..|||..|:|
Mouse    67 --------------QRHLLHALVADVDPALDPQLPLQASQRQRRSAATNAVHRCCLTGCTQQDLL 117

  Fly   131 DYC 133
            ..|
Mouse   118 GLC 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp4NP_648361.1 IlGF_insulin_bombyxin_like <115..133 CDD:239832 8/17 (47%)
Insl3NP_038592.3 IlGF_relaxin_like 27..120 CDD:239831 28/110 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_127938
Panther 1 1.100 - - LDO PTHR10423
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.