DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp4 and Insl3

DIOPT Version :9

Sequence 1:NP_648361.1 Gene:Ilp4 / 39152 FlyBaseID:FBgn0044049 Length:134 Species:Drosophila melanogaster
Sequence 2:XP_006252882.1 Gene:Insl3 / 114215 RGDID:620117 Length:150 Species:Rattus norvegicus


Alignment Length:153 Identity:47/153 - (30%)
Similarity:63/153 - (41%) Gaps:35/153 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LALLLLLATVSQLL--QPVQGRRKMCGEALIQALDVICVNGFTRRVRRSSASKDARVRDLIRKLQ 70
            |.||||||..|.|.  ||.:.|.|:||..|::||..:|  |..|....::...|.|.|      .
  Rat     4 LLLLLLLALGSALRSPQPPEARAKLCGHHLVRALVRVC--GGPRWSPEATQPVDTRDR------T 60

  Fly    71 QPDEDIEQETETGR------------LKQKH------TDADTEKGVPPAVG---SGRKLRRHRRR 114
            .|....:.....|:            |:|:|      .|||......||:.   ..:..:|.||.
  Rat    61 SPFHGHKLGCTGGKQAHRVGGELLQWLEQRHLLHALVADADPALDPDPALDPQLPHQASQRQRRS 125

  Fly   115 IA----HECCKEGCTYDDILDYC 133
            :|    |.||..|||..|:|..|
  Rat   126 VATNAVHRCCLTGCTQQDLLGLC 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp4NP_648361.1 IlGF_insulin_bombyxin_like <115..133 CDD:239832 9/21 (43%)
Insl3XP_006252882.1 IlGF_relaxin_like 27..148 CDD:239831 34/128 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I5347
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1570392at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_127938
Panther 1 1.100 - - LDO PTHR10423
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.