DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp4 and insl5b

DIOPT Version :9

Sequence 1:NP_648361.1 Gene:Ilp4 / 39152 FlyBaseID:FBgn0044049 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001122028.1 Gene:insl5b / 100008569 ZFINID:ZDB-GENE-070122-5 Length:100 Species:Danio rerio


Alignment Length:126 Identity:29/126 - (23%)
Similarity:43/126 - (34%) Gaps:31/126 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LALLLLLATVSQLLQPVQGRRKMCGEALIQALDVICVNGFTRRVRRSSASKDARVRDLIRKLQQP 72
            ||:||:.|..:...|..:|.| :||....:|:...|.....|||                :.:.|
Zfish     6 LAVLLVFAACADSAQAQKGLR-LCGREFFRAVVYTCGGSRWRRV----------------QTEDP 53

  Fly    73 DEDIEQETETGRLKQKHTDADTEKGVPPAVGSGRKLRRHRRRIAHECCKEGCTYDDILDYC 133
            ....|.|.:...|.....|              |:.|.....:...|||.||...|::..|
Zfish    54 VNGYEIEADVESLTSAEMD--------------RERREVYETLPSTCCKVGCRKSDLVRMC 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp4NP_648361.1 IlGF_insulin_bombyxin_like <115..133 CDD:239832 6/17 (35%)
insl5bNP_001122028.1 IlGF_relaxin_like 24..100 CDD:239831 22/106 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.