DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp3 and Ilp2

DIOPT Version :9

Sequence 1:NP_648360.2 Gene:Ilp3 / 39151 FlyBaseID:FBgn0044050 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_524012.1 Gene:Ilp2 / 39150 FlyBaseID:FBgn0036046 Length:137 Species:Drosophila melanogaster


Alignment Length:129 Identity:38/129 - (29%)
Similarity:58/129 - (44%) Gaps:33/129 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SLLLLILMIGGVQATMK-----LCGRKLPETLSKLCVYGFNAMT--KR----------TLDPVNF 63
            |::.:||:   ..:|:|     ||..||.|.||.:| ..:|.:.  ||          .|:|:.|
  Fly     9 SMVAVILL---ASSTVKLAQGTLCSEKLNEVLSMVC-EEYNPVIPHKRAMPGADSDLDALNPLQF 69

  Fly    64 NQIDGFEDRSLLERLLS------------DSSVQMLKTRRLRDGVFDECCLKSCTMDEVLRYCA 115
            .|....||.|:.|.|.|            :|..::.:..|.|.|:.:.||.|||.|..:..||:
  Fly    70 VQEFEEEDNSISEPLRSALFPGSYLGGVLNSLAEVRRRTRQRQGIVERCCKKSCDMKALREYCS 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp3NP_648360.2 IlGF_insulin_bombyxin_like 33..114 CDD:239832 31/104 (30%)
Ilp2NP_524012.1 IlGF_insulin_bombyxin_like <111..132 CDD:239832 8/20 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D136481at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13647
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.