DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ilp3 and IGF2

DIOPT Version :9

Sequence 1:	NP_648360.2	Gene:	Ilp3 / 39151	FlyBaseID:	FBgn0044050	Length:	120	Species:	Drosophila melanogaster
Sequence 2:	NP_001121070.1	Gene:	IGF2 / 3481	HGNCID:	5466	Length:	236	Species:	Homo sapiens

Alignment Length:	123	Identity:	29/123 - (23%)
Similarity:	46/123 - (37%)	Gaps:	36/123 - (29%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MGIEMRCQDRRILLPSLLLLILMIGGVQATMKLCGRKLPETLSKLC---VYGFNAMTKRTLDPVN 62
            |||.|. :...:||..|......|...:.:..|||.:|.:||..:|   .:.|:....|.
Human    57 MGIPMG-KSMLVLLTFLAFASCCIAAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRV----- 115

  Fly    63 FNQIDGFEDRSLLERLLSDSSVQMLKTRRLRDGVFDECCLKSCTMDEVLRYCAAKPRT 120
                                      :||.| |:.:|||.:||.:..:..|||...::
Human   116 --------------------------SRRSR-GIVEECCFRSCDLALLETYCATPAKS 146

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ilp3	NP_648360.2	IlGF_insulin_bombyxin_like	33..114	CDD:239832	18/83 (22%)
IGF2	NP_001121070.1	nt_trans	<4..51	CDD:320711
		IlGF	84..147	CDD:239834	21/95 (22%)
		IGF2_C	168..222	CDD:285554
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1644517at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.010