DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp3 and Igf2

DIOPT Version :10

Sequence 1:NP_648360.2 Gene:Ilp3 / 39151 FlyBaseID:FBgn0044050 Length:120 Species:Drosophila melanogaster
Sequence 2:XP_008758296.1 Gene:Igf2 / 24483 RGDID:2870 Length:326 Species:Rattus norvegicus


Alignment Length:120 Identity:30/120 - (25%)
Similarity:47/120 - (39%) Gaps:30/120 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGIEMRCQDRRILLPSLLLLILMIGGVQATMKLCGRKLPETLSKLCVYGFNAMTKRTLDPVNFNQ 65
            |||.:. :...:||.||...:..|...:.:..|||.:|.:||..:|                   
  Rat   165 MGIPVG-KSMLVLLISLAFALCCIAAYRPSETLCGGELVDTLQFVC------------------- 209

  Fly    66 IDGFEDRSLLERLLSDSSVQMLKTRRLRDGVFDECCLKSCTMDEVLRYCAAKPRT 120
                .||.......|..:     .||.| |:.:|||.:||.:..:..|||...::
  Rat   210 ----SDRGFYFSRPSSRA-----NRRSR-GIVEECCFRSCDLALLETYCATPAKS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp3NP_648360.2 IlGF_insulin_bombyxin_like 33..114 CDD:239832 19/80 (24%)
Igf2XP_008758296.1 IlGF 192..255 CDD:239834 22/92 (24%)

Return to query results.
Submit another query.