DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp3 and ins-1

DIOPT Version :9

Sequence 1:NP_648360.2 Gene:Ilp3 / 39151 FlyBaseID:FBgn0044050 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_501926.1 Gene:ins-1 / 177936 WormBaseID:WBGene00002084 Length:109 Species:Caenorhabditis elegans


Alignment Length:116 Identity:31/116 - (26%)
Similarity:49/116 - (42%) Gaps:28/116 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RRILLPSL---LLLILMIGG---VQATMKLCGRKLPETL-----SKLCVYGFNAMTKRTLDPVNF 63
            |::..||.   .|.||::..   ..|:::|||.:|..||     ::||. |..|. ||:.|    
 Worm     5 RQVYRPSFFFGFLAILLLSSPTPSDASIRLCGSRLTTTLLAVCRNQLCT-GLTAF-KRSAD---- 63

  Fly    64 NQIDGFEDRSLLERLLSDSSVQMLKTRRLRDGVFDECCLKSCTMDEVLRYC 114
             |......|.|..          :..::.|.|:..|||.|.|:...:..:|
 Worm    64 -QSYAPTTRDLFH----------IHHQQKRGGIATECCEKRCSFAYLKTFC 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp3NP_648360.2 IlGF_insulin_bombyxin_like 33..114 CDD:239832 23/85 (27%)
ins-1NP_501926.1 IlGF_insulin_bombyxin_like 34..103 CDD:239832 23/85 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109163
Panther 1 1.100 - - LDO PTHR13647
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.