DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp3 and Igf2

DIOPT Version :10

Sequence 1:NP_648360.2 Gene:Ilp3 / 39151 FlyBaseID:FBgn0044050 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_034644.2 Gene:Igf2 / 16002 MGIID:96434 Length:191 Species:Mus musculus


Alignment Length:120 Identity:30/120 - (25%)
Similarity:45/120 - (37%) Gaps:30/120 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGIEMRCQDRRILLPSLLLLILMIGGVQATMKLCGRKLPETLSKLCVYGFNAMTKRTLDPVNFNQ 65
            |||.:. :...:||.||...:..|........|||.:|.:||..:|                   
Mouse    12 MGIPVG-KSMLVLLISLAFALCCIAAYGPGETLCGGELVDTLQFVC------------------- 56

  Fly    66 IDGFEDRSLLERLLSDSSVQMLKTRRLRDGVFDECCLKSCTMDEVLRYCAAKPRT 120
                .||.......|..:     .||.| |:.:|||.:||.:..:..|||...::
Mouse    57 ----SDRGFYFSRPSSRA-----NRRSR-GIVEECCFRSCDLALLETYCATPAKS 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp3NP_648360.2 IlGF_insulin_bombyxin_like 33..114 CDD:239832 19/80 (24%)
Igf2NP_034644.2 IlGF 39..102 CDD:239834 22/92 (24%)
IGF2_C 123..177 CDD:462445
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.